KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_01401Help
Entry
ABTJ_01401        CDS       T02045                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABTJ_01401
Enzymes [BR:abr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ABTJ_01401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455468..1455905
Genome map
AA seq 145 aa AA seqDB search
MNAPEIIFALALASNLDAAQHFTFAYTQLATLGKVQFSSVYQIPCRDGIGDDYWNSACLL
KSTLSSEQIESFLKKLESDSGRVRPSHHISLDVDLIAWGSDLDHMQFNSKKLPLALDVKI
PLYELWDCETLKADSTLYPVVNFKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccagaaataatttttgcgctcgctctagcgagtaatttagacgcagcacaa
cactttacttttgcttatacgcaattagcaactttggggaaagtgcagttttcatctgtt
tatcaaattccatgccgagatggtattggagatgattactggaactcagcgtgtctatta
aaaagcaccttatcatctgaacaaattgaatcttttttaaagaaacttgagtcagattct
gggcgtgttcgaccatcacatcatatttctttagatgtagatttgattgcatggggaagt
gatctggaccatatgcaatttaattctaaaaaattgccgttagcactcgatgtaaaaatt
cctttatatgaactttgggattgtgaaaccttaaaggctgatagcacactttatccagtc
gttaattttaaagtttaa

DBGET integrated database retrieval system