KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_01980Help
Entry
ABTJ_01980        CDS       T02045                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00260  Glycine, serine and threonine metabolism
abr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abr01100  Metabolic pathways
abr01110  Biosynthesis of secondary metabolites
abr01130  Biosynthesis of antibiotics
abr01230  Biosynthesis of amino acids
Module
abr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABTJ_01980
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABTJ_01980
Enzymes [BR:abr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABTJ_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFI95583
Position
complement(2053659..2054864)
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFYAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGKEIKEQTHQRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLDTNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSIATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLSKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacaaggattttttggtgagtat
ggaggtcagtttattcctccgcatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttattttatgcaaaacgcctttcagaacagttaggtggcgca
caaatttatttaaagcgtgaagacttaaatcatacgggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggcaaaaagaaagttattgccgaaacgggt
gcgggtcaacatggggttgctttagcaacagcttgtgctctagtgggtattccatgtgaa
atccacatggggcaagttgatattgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggcgctcatttggtgtcagtaactcgcggtacagcaaccttaaaagatgctgtagat
agcgcgtttgaagaatatttaaaagatcctaaaaactttatttatgcgattggttctgtg
gttggtccccatccatttcctaaaatggttcgagattttcaatcaattattggtaaggaa
attaaagagcagacgcatcaacgatttggtaaaaacccagattatgttgtcgcatgtgtc
ggtggcggttcaaatgcaatcggtgcctttacagcttttttaaatgattcagatgtgaaa
cttgtaggagttgaacctgctgggcatgggctagatacaaatatgcattcggcaacccta
acattaggtaaaccaagccaaattcatggtatggcatgttatgttcttgaaaatgaggct
ggtgaacctttacctgtgcattctatcgcttcaggattggactatcctggtgttgggcca
caacatagtttcttaaaagatttaggccgtgtggaatatagcattgcaactgaccaagaa
tgtttagatgcgtttatgaccttatcacgagttgaaggtattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgccaaaactgtcgaaagaaaccatgatc
gtggtaaatctgtcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system