KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02581Help
Entry
ABTJ_02581        CDS       T02045                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2669121..2669960
Genome map
AA seq 279 aa AA seqDB search
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD
EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC
RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL
SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGN
GADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggtgttcggcattctgaatctcaccgaggactccttcttcgatgagagccgg
cggctagaccccgccggcgctgtcaccgcggcgatcgaaatgctgcgagtcggatcagac
gtcgtggatgtcggaccggccgccagccatccggacgcgaggcctgtatcgccggccgat
gagatcagacgtattgcgccgctcttagacgccctgtccgatcagatgcaccgtgtttca
atcgacagcttccaaccggaaacccagcgctatgcgctcaagcgcggcgtgggctacctg
aacgatatccaaggatttcctgaccctgcgctctatcccgatattgctgaggcggactgc
aggctggtggttatgcactcagcgcagcgggatggcatcgccacccgcaccggtcacctt
cgacccgaagacgcgctcgacgagattgtgcggttcttcgaggcgcgggtttccgccttg
cgacggagcggggtcgctgccgaccggctcatcctcgatccggggatgggatttttcttg
agccccgcaccggaaacatcgctgcacgtgctgtcgaaccttcaaaagctgaagtcggcg
ttggggcttccgctattggtctcggtgtcgcggaaatccttcttgggcgccaccgttggc
cttcctgtaaaggatctgggtccagcgagccttgcggcggaacttcacgcgatcggcaat
ggcgctgactacgtccgcacccacgcgcctggagatctgcgaagcgcaatcaccttctcg
gaaaccctcgcgaaatttcgcagtcgcgacgccagagaccgagggttagatcatgcctag

DBGET integrated database retrieval system