KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02978Help
Entry
ABTJ_02978        CDS       T02045                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABTJ_02978
Enzymes [BR:abr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ABTJ_02978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3057700..3058533
Genome map
AA seq 277 aa AA seqDB search
MIRVPSPAKLNLFLHITGRRENGYHELQTIFQLIDLYDWMTFTPISEDEIQIEGLGEVQL
EQNLIYRAAQILRPHAQNPCGLHIKIEKNIPMGAGLGGGSSNAATTLIVLNQLWQCGLTE
EQLAQFGVKLGADVPIFIYGLNAWAEGIGEHLSFIDLDQKQFIVLKPDCFISTQLLFSQK
TLTRDSKPTTFCAYQLEPSNFGNNFEPLARELYPEVEEAMQYLDQFGHAKLTGTGACVFA
EVTDEMNVDDILKHAPCKAYLVHSLKESPLRHFKVAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtaccttctccagctaagctcaacctgtttttgcatatcacaggacgtcgt
gaaaatggttaccatgaactacaaactattttccaacttattgatttatatgactggatg
acatttacgcctatatctgaagatgagattcagattgaaggtttaggtgaggttcaactt
gagcaaaatctgatttatcgggcggcacagatattacgccctcacgctcaaaatccttgc
ggactccatataaaaattgaaaaaaatattccgatgggtgccggtttaggtggcggttct
tccaatgcagcaacgacgcttattgtcttaaatcaattatggcaatgtggtctaactgaa
gaacaattagctcagttcggtgtcaagcttggtgccgatgttccaatttttatttatggg
ttaaatgcatgggctgaagggattggtgaacatttatcattcatagacttagatcaaaaa
caattcattgttttaaaacctgattgttttatcagcactcaactgcttttttcacaaaaa
acattgacaagagattctaagcccactacattttgcgcctatcagttagaaccttctaat
ttcggaaataactttgagcctttggctagagagttataccctgaagttgaagaagcaatg
caatatctcgatcagtttggtcatgcaaagcttacaggtacaggtgcttgtgtttttgct
gaggtaaccgatgaaatgaatgttgatgacattcttaaacatgcaccatgtaaagcttac
ttggtacatagtttaaaagaatctcctttacgtcattttaaagttgcaagttag

DBGET integrated database retrieval system