KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03146Help
Entry
ABTJ_03146        CDS       T02045                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABTJ_03146
  Amino acid metabolism
   00340 Histidine metabolism
    ABTJ_03146
Enzymes [BR:abr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ABTJ_03146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3238847..3240169)
Genome map
AA seq 440 aa AA seqDB search
MVFLFRLVGKLMRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHGDDHVL
KLTQQFDRHPAHQFSDLELSQQQLKAAFDGLNQEIREALKLAADRIRTFHEAQKQDSWTY
VDDLGNTLGQKVTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPAPNGELN
PLVLAAAYLAGVSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKRAVFGQVG
IDMIAGPSEILVYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAVESAIEKHL
NELPKAEIARTSIKNRGALVLVKDRAEAVDLINQVAPEHLELCLDDAEAMSQDIRHAGAI
FMGRYTPEAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSKDGVKTLAKTAD
VLAVQENLDAHARSARYRYQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttggtttttctttttcgccttgtgggtaaattgatgcgacgtttatcgactcaagatcag
aacttcaaacaggtttttgccgagcttttagcttttgaaaccgttaatgatcctaattta
gttcaaacagtagatcaaattattgctgatgttcgtcagcatggtgatgatcatgtttta
aaacttactcaacagttcgatcgacatccagcgcatcaattttccgatctagaattgtct
caacaacaacttaaagctgcttttgatggtttaaatcaagagattcgtgaagccctgaaa
cttgcagctgatcgtattcgtacttttcatgaagctcaaaaacaagatagctggacttat
gtggatgatttgggtaataccctaggacaaaaagtgactccacttgaccgtgttggtatt
tatgtaccaggcggacttgcatcttatccttcatctgtacttatgaatgcggtaccagca
catgtggctggtgtacctgaaattattatggttgtgccagccccaaatggtgaactaaat
ccactcgttttagctgccgcctatctagcaggtgttagccgagtatttaccattggtggg
gcacaagctgttgctgctttagcttatggtactcaaactgttccacgtgttgataaaatt
acgggtcctggaaaccgatttgtggcagctgctaaacgtgctgtatttggtcaggtgggt
attgacatgattgctggaccttctgaaatattagtttatgcagaaggtgtgaataatgct
gaatggttagcgatggatgtattatctcaagctgaacatgacacagtagctcaagctatt
ttcattactccagatgaagcattattagaagcagtagagtctgcaattgagaaacattta
aatgaattgcctaaagccgagattgcgcgtacatcgattaaaaatcgtggtgcattagtt
ttggtaaaagaccgtgctgaagcagttgatttaattaatcaggttgcaccagagcatttg
gaactatgtcttgatgatgctgaagcgatgagccaagatattcgtcatgcaggggcaatt
tttatgggtcgctatacacctgaagcaattggtgattattgtgctggcccaaaccacgta
ttaccgacatcaggcacagctcgtttctcttcgccacttggtgtatatgattttcaaaag
cgctctagtttgatcatgtgttcaaaagatggcgttaagactttggctaaaacagctgat
gtacttgctgttcaagaaaatctcgatgcccatgcacgctcggcgcgttatcgttatcaa
taa

DBGET integrated database retrieval system