KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03317Help
Entry
ABTJ_03317        CDS       T02045                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:abr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3422939..3423448
Genome map
AA seq 169 aa AA seqDB search
MAWQNVKVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRAL
PNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQALFIIGGGEIFKQTLSIA
DRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaaatgtaaaagttgtccacgttgtcgcaatggacaaaaatcactgtatt
ggtaaaggcaatgcgttgccatggcatatctctgccgacttaaaacactttaaagaaatc
acacaaggtggtgtggtgatcatgggccgcaaaacgcttgagtctatgggccgtgctcta
ccgaaccgtgtgaactgggtaattacccgtgacattaactggcattttgacggcgtaaaa
attgcgtattcaattgaagatgctttaaatgctgctttagaagatgccaaaaacaccgaa
aagcaagctttattcattattggtggtggtgaaatctttaagcaaaccttgtcaattgca
gaccgtcttgagctcactcatgttgacttagatgtacaaggtgatgcacattatccaaca
ataccgagtgaatttcacaaaactgcaagcgaacagcaagtagatgaaaaatcaggaact
tcattcgaatttgccacttataaaaaataa

DBGET integrated database retrieval system