KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03417Help
Entry
ABTJ_03417        CDS       T02045                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABTJ_03417
Enzymes [BR:abr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABTJ_03417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3525885..3527636)
Genome map
AA seq 583 aa AA seqDB search
MDNLNSPEQSDLSWLTTWSTFLNQAPFTAQTQAPEAAYFLQQLIEASLQGDSCIEISPEQ
IETLGQLVISAEQAKSQVAPCVHDEQGLALYRYWNLEQRLAEQIRRLKQQPIQPVSCEEH
LDLLTDPHQQAALQMVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLISAELRNQSTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSENRVH
LQTSRRFAEGALIGQVARFIQMQTSQINHEQILQKFEIDIVQVSELRSIPLETDMPDVVQ
LEYLPEESPIALETYYQKLMVDFQGYVQSLKAYIQDDRSLEHIENIVRSFDDYRILTAVR
HGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctaaatagccctgaacaaagcgatttaagctggttaacgacttggagtacc
tttctaaatcaagccccgtttactgcacagacacaagctccagaggcagcttattttttg
cagcagctgattgaagcgagcttgcagggtgacagttgtattgagattagcccagagcaa
atagaaacacttggccaactggtgatatctgctgaacaagcaaagtctcaagttgcccct
tgtgtccacgacgagcaggggttggcattataccgatattggaacctagagcaacgtcta
gctgagcaaattcgccgattaaagcaacaaccaattcaacctgtttcatgtgaagagcat
ttagacttattaacagatcctcatcagcaagctgctttgcaaatggtgactcggcagagc
ttaagtattattacaggtgggccgggtacaggtaagacctatacgctcgctcgtattatt
gctgtgcttagtcaggcaattccacatattcgtgtagcgatggctgctccgacgggtaaa
gctgcacagcgtatgcaagaagccttacaaaactcctttaatgacccaaaactgcttgag
tcggggttaataagtgctgagctaagaaaccaaagtacccaaactatccatcgattatta
ggtatggggcatagtcaaactccacggtttaatcaaaaacagcctttgccttatgacgtt
attgtggtggatgaagcctctatgctggacttaaatctggcaacgttattatttgaagcg
gttcctgagtcttgtcgaattattttattaggtgatgccaaccagcttgcttccgtagac
gtcggagctgtacttgcagatttacagcaaatcgaggctttgtctgaaaaccgtgttcac
cttcaaaccagccgtcgttttgcggaaggggctttgattggtcaggttgcccgatttatt
caaatgcaaaccagtcaaatcaaccatgagcaaattttacaaaaatttgaaatcgatatt
gttcaggtttcagagttacgttcaatacctttagaaaccgacatgcccgatgtggttcag
cttgaatatttacccgaagagtcacctatagcgctagaaacttactaccaaaaattgatg
gtggattttcaaggctatgtgcaaagcttaaaagcttatatacaagatgatcgttcactt
gaacatattgaaaatatcgttaggtcattcgatgactaccgtattttaactgccgtacgt
catggaccatttggtttacagcaacttaatcaatatgctgaacgctggttacaacaacag
ctaggtattgtgactttaggaggatggtatgttggccgtccggttatgatgacctataac
gattaccagctcggtatttcaaatggtgacattggtttatgttttgaacatagaacccag
ccgcaacagtttgaagtgtattttccaagtttaaataagtgggttgctgcaaatcggcta
cctaaaagtattcaaagtgcatttgccttaacaattcacaaatcacaaggttctgaattt
acccatacagctgttgttcttgatcaggctgccaagaatttgttaagccaagagttgatc
tacactgcgattacacgagccaaaaaagtagtgagtttattggtcgatccagaggcgtta
cttcaatcttttacagttcgcacgacaagaaaaagcggtttagttgaaaaagttaatcgg
ttagttcgttaa

DBGET integrated database retrieval system