KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03444Help
Entry
ABTJ_03444        CDS       T02045                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABTJ_03444
   01230 Biosynthesis of amino acids
    ABTJ_03444
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABTJ_03444
   00051 Fructose and mannose metabolism
    ABTJ_03444
   00562 Inositol phosphate metabolism
    ABTJ_03444
Enzymes [BR:abr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABTJ_03444
Exosome [BR:abr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABTJ_03444
  Exosomal proteins of bladder cancer cells
   ABTJ_03444
  Exosomal proteins of melanoma cells
   ABTJ_03444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3559564..3560358)
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQA
QLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEIL
KAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVQAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaatccaatgcgt
gccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaaattgca
gatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacggtacaagcg
caattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgtgttgct
ggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaaattaat
ttcgtacttgtaggacactctgaacgtcgtgatatttttggtgacaacgttgaaattttg
aaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtgggcgaa
agccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaaatttgtgat
attgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcctatgaacct
atttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatgcacgct
aaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgctattttatat
ggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatcaatggt
gcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaagccttc
gcgcaaagcaaataa

DBGET integrated database retrieval system