KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03576Help
Entry
ABTJ_03576        CDS       T02045                                 

Definition
dihydropteroate synthase
Orthology
K18824  
dihydropteroate synthase type 1/2 [EC:2.5.1.15]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Folate biosynthesis
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABTJ_03576
Enzymes [BR:abr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ABTJ_03576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3693865..3694731)
Genome map
AA seq 288 aa AA seqDB search
MSYLFLSCTEIIIIEAPMNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGAD
VIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYL
NDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTG
AGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRG
PGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagttatctatttttatcgtgtacagagattattattatagaagcccccatgaataaa
tcgctcatcattttcggcatcgtcaacataacctcggacagtttctccgatggaggccgg
tatctggcgccagacgcagccattgcgcaggcgcgtaagctgatggccgagggggcagat
gtgatcgacctcggtccggcatccagcaatcccgacgccgcgcctgtttcgtccgacaca
gaaatcgcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcattcccgtctcg
ctcgacagttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtggcctatctc
aatgatattcgcggttttccagacgctgcgttctatccgcaattggcgaaatcatctgcc
aaactcgtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgaggcacccgct
ggcgacatcatggatcacattgcggcgttctttgacgcgcgcatcgcggcgctgacgggt
gccggtatcaaacgcaaccgccttgtccttgatcccggcatggggttttttctgggggct
gctcccgaaacctcgctctcggtgctggcgcggttcgatgaattgcggctgcgcttcgat
ttgccggtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcacaggccgtggt
ccgggggatgtcggggccgcgacactcgctgcagagcttgccgccgccgcaggtggagct
gacttcatccgcacacacgagccgcgccccttgcgcgacgggctggcggtattggcggcg
ctgaaagaaaccgcaagaattcgttaa

DBGET integrated database retrieval system