KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03647Help
Entry
ABTJ_03647        CDS       T02045                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABTJ_03647
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABTJ_03647
Enzymes [BR:abr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABTJ_03647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3764783..3765328
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQALTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPNLTADDEQIVKAVEAELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaagctatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggcttagaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagaacctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagcgctaacaacagctcaaccagaacgtattgga
gaaggccctttccgtgagcgcttagaaggtttaggtattcctactaaccctgcccctgaa
gtgttatggaatttcgagaaattcctagtaaataaaaacggtgaagttgttgcgcgtttt
gcacctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagcagaattagct
aaataa

DBGET integrated database retrieval system