KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_03704Help
Entry
ABTJ_03704        CDS       T02045                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00071  Fatty acid degradation
abr00280  Valine, leucine and isoleucine degradation
abr00281  Geraniol degradation
abr00310  Lysine degradation
abr00360  Phenylalanine metabolism
abr00362  Benzoate degradation
abr00380  Tryptophan metabolism
abr00410  beta-Alanine metabolism
abr00627  Aminobenzoate degradation
abr00640  Propanoate metabolism
abr00650  Butanoate metabolism
abr00903  Limonene and pinene degradation
abr00930  Caprolactam degradation
abr01100  Metabolic pathways
abr01110  Biosynthesis of secondary metabolites
abr01120  Microbial metabolism in diverse environments
abr01130  Biosynthesis of antibiotics
abr01212  Fatty acid metabolism
Module
abr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABTJ_03704
   00650 Butanoate metabolism
    ABTJ_03704
  Lipid metabolism
   00071 Fatty acid degradation
    ABTJ_03704
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABTJ_03704
   00310 Lysine degradation
    ABTJ_03704
   00360 Phenylalanine metabolism
    ABTJ_03704
   00380 Tryptophan metabolism
    ABTJ_03704
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABTJ_03704
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABTJ_03704
   00281 Geraniol degradation
    ABTJ_03704
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABTJ_03704
   00627 Aminobenzoate degradation
    ABTJ_03704
   00930 Caprolactam degradation
    ABTJ_03704
Enzymes [BR:abr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABTJ_03704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFI97252
Position
complement(3823531..3824304)
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDREIGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
TKEELLEQTLQAAEKIAVRSLTANMILKETINRAFEVNLTEGLRFERRMFHSIFATFDQK
EGMQAFVEKRKANFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggggttggactgattacattaaat
cgccctcaagcgctcaatgctttaaacagcgaattaattagtgaaattaatcaggcatta
gatcagctcgaaaaagaccgcgaaattggttgcatcgtattagcaggttctgaaaaggct
tttgccgcaggagctgacattaaagaaatggctgatttggcatttcctgatatttattta
gatgacttttttcatcttgcagaccgtattgcacagcgccgtaaacctctaattgcagcg
gtgagtggctatgcattgggtggtggctgtgagttggcgctgatgtgtgactttatttat
tgtgctgataacgccaagtttggcttacctgaagtgaccttaggtgtaattcccggcatt
ggcggtacacaacgcttaacccatgcgattggtaaagccaaagcaatggaaatgtgcctt
accgctcgtcaaatgggcgctgtagaagcagagcaaagtggtttagtcgcacgtgtgttt
actaaagaagaattacttgaacaaaccttgcaagccgctgaaaaaattgcggtacgctct
ttaacagcaaatatgattcttaaagaaaccatcaaccgagcttttgaagtaaaccttact
gaaggcttgcgttttgaaagacgtatgttccattcaatatttgcaacatttgaccaaaaa
gaagggatgcaggcttttgttgaaaaacgaaaggcaaattttaaaaatcaataa

DBGET integrated database retrieval system