KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_p0044Help
Entry
ABTJ_p0044        CDS       T02045                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abr  Acinetobacter baumannii MDR-TJ
Brite
Enzymes [BR:abr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABTJ_p0044
Secretion system [BR:abr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABTJ_p0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pABTJ1:complement(34706..35443)
Genome map
AA seq 245 aa AA seqDB search
MNKLNLSIGILLAIATSLTHATKTDDVKAKVLQNYPATTVSQVNETPLKNIFEVVMGKNV
AYTDEEARYFIFGNLFDMKTQTDLTTTPSNKIEIGFPSKERLKDAVKTVKGNGKRKLAVF
SDPDCPYCQQLEHNLQSITDVTIYTFLFPLESLHPRAKGTAISIWCAKDQSKAYHEYMLN
NKQPQVKSCENPIDRNIQFGGSMGIQGTPSVIFEDGSLIPGAISAPELERQLQEANKKVN
GGISK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattaaatctatctatcggtatcttattagcaattgcaacatcactaactcat
gcaactaagactgatgatgttaaagccaaagtgttacaaaactatccagcaacaacagta
tctcaagtaaacgaaacgccactgaagaatatctttgaagtcgttatgggtaaaaatgtt
gcctatacggacgaagaagcaagatattttatctttggcaacttgtttgacatgaagaca
cagactgatttaacaactactcctagcaataaaattgaaatagggttcccatctaaagaa
cgtctaaaagatgccgtcaaaactgttaaagggaatggaaaaagaaaattagctgttttc
agtgatccagattgcccgtattgccaacagcttgagcataacctgcaatcaattactgat
gtaacaatttacacgttccttttccctcttgagagcttacatccgcgtgctaaaggaact
gcaatttcaatatggtgcgctaaagatcaatcaaaagcctatcacgaatacatgcttaac
aataagcaacctcaagttaagtcatgtgaaaacccaattgatcgcaatattcagtttggg
ggaagtatgggaattcaaggcacacctagtgtgatctttgaagatggatctctcatccct
ggcgctattagtgcacctgaattagaacgtcaattgcaggaagcaaataagaaagtaaat
ggagggataagcaaatga

DBGET integrated database retrieval system