KEGG   Acholeplasma brassicae: BN85309340Help
Entry
BN85309340        CDS       T03095                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abra  Acholeplasma brassicae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:abra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN85309340 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN85309340 (atoB)
   00640 Propanoate metabolism
    BN85309340 (atoB)
   00650 Butanoate metabolism
    BN85309340 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    BN85309340 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BN85309340 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN85309340 (atoB)
   00310 Lysine degradation
    BN85309340 (atoB)
   00380 Tryptophan metabolism
    BN85309340 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN85309340 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN85309340 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN85309340 (atoB)
Enzymes [BR:abra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN85309340 (atoB)
Exosome [BR:abra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN85309340 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1022865..1024079)
Genome map
AA seq 404 aa AA seqDB search
MSNKVYIVGAKRSPIGSFLGTLKDLHPAEIGVQVLKQLFIESKIPRDQIDEVIVGNVIQA
GLGQNVARQIAIKSGVPQEVPAYTVNMVCGSGMKTVMNAYVSIKAGMSNLVVAGGVESMS
YAPYIVDAKIRSGNKMGNLEMKDSILKDALHDSFTEGMHMGITAENIASKHGLSREALDQ
FAYESQQKAIKAVDEGRFKDEIVPIEIKTRKETIIFDQDEYPNRQTSLEKMTKLRPAFKS
DGLVTAGSSSGINDGASFVILASESAVKAHNLTVIAEVVGIGQAGVDPNVMGLGPVPAVK
HALNHANLKLSQIDLVELNEAFASQSLGVIEEVIAEHHVDKETFMQKTNVNGGAIALGHP
VGVSGNRIIVTLVHEMKKRSLTYGLASLCIGGGMGTALIIKRGE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaagtatatattgtaggtgcaaagagaagtccaatcggcagttttcttggt
acgttaaaggatttacacccggcggaaatcggtgtgcaagtgttaaaacagcttttcatc
gagtctaagataccaagagatcaaatcgatgaagtgattgttggtaatgtgatccaagcc
ggtttaggacaaaacgttgctagacaaattgcgatcaaatcaggtgtacctcaagaagtg
ccagcctacactgtcaatatggtctgtggtagtggtatgaagaccgtgatgaacgcatac
gtgagtataaaagcaggtatgtctaatttggttgttgctggtggggttgaatccatgagc
tatgcaccgtatattgtcgatgctaaaatacgcagtggtaataagatggggaacttggaa
atgaaggattcaatcttaaaggatgcgcttcatgactcgtttactgaaggcatgcatatg
ggcatcactgctgaaaatattgcgtctaaacatggtctttcaagagaagcactcgatcaa
tttgcttacgaaagtcaacaaaaggcaatcaaagcggtagacgaaggtcgtttcaaagat
gaaattgttccaatcgagattaaaacaagaaaagaaacaataatatttgatcaagacgaa
tacccaaaccgtcagacaagtttagaaaagatgacaaaacttcgtccagcgtttaaatca
gacggtcttgtgactgccggttcatcctctggaattaatgatggtgcaagctttgtgata
ttagcaagcgaatcagcggttaaagcacataatttgacggtgattgctgaggtcgtaggc
attggacaagcaggtgttgatccaaatgtgatgggcttaggtccagttccagcagtgaaa
catgcgcttaatcatgcgaatttaaaactaagtcaaattgatttagttgaacttaatgaa
gcattcgcttcacaaagtttaggtgtgattgaagaagtgattgctgaacaccacgtcgat
aaagaaacatttatgcaaaagaccaatgtgaatggtggggcaattgcactaggacaccct
gttggtgtttctggtaaccgtattattgttacgttggtgcatgaaatgaaaaaaagaagt
ctgacttatggcctcgctagcctttgtattggcggcggcatggggacagcgctcataatt
aaaagaggagaataa

DBGET integrated database retrieval system