KEGG   Acholeplasma brassicae: BN85313370Help
Entry
BN85313370        CDS       T03095                                 

Definition
Glycosyl hydrolase, family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
abra  Acholeplasma brassicae
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abra00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BN85313370
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN85313370
Enzymes [BR:abra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BN85313370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1459465..1460811)
Genome map
AA seq 448 aa AA seqDB search
MKKLWMVMILSMIFVSGCETKKVFVGEVYLTSERLESYLEFKESLMSTKEESTHSIIRIE
SNKTYQVIDGFGAAMTESSAYNLKNAIKKEEMLKALFSKEGINLNMVRLTMGSSDFSLSN
QTYQPTATSPFSIESDRLILDILNEIEQDIKYVSSPWTAPAWMKDSQALNGGNFLNSYTK
TYVNYFLNYIEAYQKEGIEIYAVTPQNEPLHQTPNYPSMLMSALVQAGFIHELKTQLIKE
NLDVKIFGFDHNFKDIGYPKTLLNSKLSRESMDGLAFHCYDGDVSSLNDEAFEGIDLYIT
ECSGGRWATHFTSNLLWNMENLLIGGLNQNVKGVMLWNLVLDENDGPKNGGCMNCRGVLT
KTDQGYQKNVEYYALGHFSKFHQNGAKRIETTSSNVNILATSFKNHDGSIVLVAANKTTI
DLKTSIYVDGAYYQYTIPKESVITIEFK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactatggatggtgatgattttgagtatgatttttgtatcgggatgtgaaaca
aaaaaagtgtttgtcggggaagtctatttaacctcagaacgtttggagtcttatcttgaa
tttaaagagagtttaatgagtacaaaagaagaaagtacacattcaattattcgaatcgaa
tcaaacaaaacgtatcaagtcattgatggttttggtgcggcaatgactgagtcgagtgct
tacaatttaaaaaatgccattaagaaggaagaaatgcttaaagcgttattctctaaagag
ggtattaatttaaatatggttcgtttaacgatgggatcgtcggatttttcattgtcgaat
caaacgtatcaaccaacggctacaagtccgttttcaatcgaaagtgatcgactcatatta
gatatattaaacgagatagaacaagacatcaaatacgtctcttccccatggaccgcgcct
gcttggatgaaagatagtcaagccttaaatggtggtaactttttaaatagctatacaaaa
acctatgttaactactttttaaactacatagaggcatatcaaaaagaaggcattgaaatc
tatgcggtaacgccacaaaatgaaccgcttcatcaaacgccaaattacccttcgatgtta
atgagtgcactagttcaagccggttttatacatgaacttaaaacccaattaatcaaagaa
aatttggatgtaaaaatattcggctttgatcataattttaaagacatcggttaccctaaa
accctattaaatagtaaactctcaagggagtctatggatggcttagcgtttcattgttac
gacggggatgtgagtagtttaaatgatgaagcgtttgagggtattgatttatacattacc
gaatgcagtggcggaagatgggcaacccatttcacctctaatttactttggaacatggag
aatttactcattggcggattaaatcaaaacgttaaaggtgtgatgctttggaatttagta
cttgatgaaaacgatggaccgaaaaatggtgggtgcatgaattgtcgcggggttttgaca
aaaacggatcaaggttatcaaaagaatgtggagtattatgccttaggacacttctctaaa
tttcatcaaaacggtgcaaaacggatcgagacaacaagttctaatgtaaacattttagca
acttcatttaaaaaccatgatgggtctatcgtgctcgtggccgcaaataaaacgacgatt
gatttaaaaactagcatctatgttgatggtgcgtattaccaatacacaataccaaaagaa
tcggtcataacgattgaatttaagtaa

DBGET integrated database retrieval system