KEGG   Azospirillum brasilense: AZOBR_100017Help
Entry
AZOBR_100017      CDS       T02152                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
abs  Azospirillum brasilense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:abs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:abs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abs00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:abs00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:abs00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:abs00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:abs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304821..1305906
Genome map
AA seq 361 aa AA seqDB search
MTAGKRIGILTSGGDCAGLNAVIRAVVHRAVLTYGWQVLGIKEGTQGLLQRPVQYQVLDL
PQVDGNMMRMGGTILGTTNRGDPFAYPMADGTQKDRSDEIIGGYRELGLDALIGIGGDGS
FAILKKLADKGGFQMVGIPKTIDNDLGLTEVSVGYDTAVGVAVEALDRLQPTAASHARVM
VLEVMGRDAGHIALAAGIAGGADVVLIPEIAYSIEKIAQKIKQVRSTGRNFALVVVSEAV
KTVDGTGVQKLFQGGQKRYGGIGDYIGEKIAEATGAETRVTVLGHVQRGSMPSPRDRLVA
SAFGVHAVDLIAEGKFDRMVAWSDRGVIDVPITEAIAKYACVELDGAMVKTARGLGISLG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaggcaagcgcatcggcattctcaccagcggcggcgactgcgccgggctgaac
gcggtcatccgcgcggtggtccaccgggccgtcctgacctacggctggcaggtcctgggc
atcaaggaaggcacccaggggttgctgcagcgtccggtgcagtatcaggtgctcgacctg
ccgcaggtcgacggcaacatgatgcgcatgggcggcaccatcctcggcacgaccaaccgc
ggcgaccccttcgcctacccgatggccgacggcacccagaaggaccggtcggacgagatc
atcggcggctaccgtgagctggggctggacgcgctgatcggcatcggcggcgacggcagc
ttcgccatcctgaagaagctggccgacaagggcggcttccagatggtcggcatccccaag
accatcgacaacgatctcggcctgaccgaggtgtcggtcggctacgacaccgccgtcggc
gtggcggtcgaggcgctcgaccggctccagccgaccgcggccagccacgcccgcgtcatg
gtgctggaggtgatgggccgcgacgccggccacatcgcgctggccgcgggcatcgccggc
ggcgccgacgtggtgctgatccccgagatcgcctattccatcgagaagatcgcccagaag
atcaagcaggtgcgctcgaccggccgcaacttcgcgctggtcgtggtgtcggaggcggtg
aagaccgtggacggcaccggcgtgcagaagctgttccagggcggccagaagcgctacggc
ggcatcggcgactacatcggcgagaagatcgccgaggcgacgggggcggagacccgcgtc
accgttctgggccacgtccagcgcggcagcatgcccagcccgcgcgaccgtctggtcgcc
tcggccttcggcgtgcacgccgtggacctgatcgccgagggcaagttcgaccgcatggtc
gcctggtcggaccgcggcgtcatcgacgtgccgatcaccgaggccatcgccaagtacgct
tgcgtggaactggacggcgccatggtcaagaccgcccgcggcctgggcatcagcctgggc
gactga

DBGET integrated database retrieval system