KEGG   Azospirillum brasilense: AZOBR_100215Help
Entry
AZOBR_100215      CDS       T02152                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abs  Azospirillum brasilense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1488391..1489551
Genome map
AA seq 386 aa AA seqDB search
MPPIAKTPIAKPAPKSAAGSLASFAPWAGEGGVRVYLRPVGLLPIAAWSAGAAVPLAGGR
FSFATAELIVRQGARIERAFAPLTEIMAWGWERGTAVAQSLDKRLGALTRGRAPFAGLDL
GRPRIMAIVNVTPDSFSDGGDFFDAGTAIAHGEAMLEAGADLLDVGGESTRPGSAPVSPE
EEEARVLPVVRHFAAKGAVVSVDTRHARVMRAALDAGAALINDVAGLRDPGALPLVAEKA
APVVVMHMRGEPGTMQQNPTYEDATLDVFDWLEERVEACLAAGVALERIAVDPGIGFGKT
VEHNLDILRHTALYHGLGCALLIGLSRKTLIGKLSRSEPPKERLAGSLTGGLETLNQGAQ
ILRVHDVPQTIQARAVWEGLHPARVP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgatcgcaaagaccccgatcgccaaacccgccccgaaatccgccgccggctcg
ctcgcctccttcgcgccctgggcgggggagggcggtgtccgcgtctatctgaggccggtc
gggctgctgcccatcgccgcctggagcgccggggcggcggtgccgctggctggcggacgc
ttttccttcgccaccgccgagctgatcgtccggcagggggcacggatcgagcgggccttc
gcgccgctgaccgaaatcatggcctgggggtgggagcgcggcaccgccgtggcgcagagc
ctggacaagcggctgggcgcgctgacccgcggacgggcgccgttcgccgggctggacctc
gggcgtccgcgcatcatggccattgtcaacgtgacgccggacagcttttccgatggcggc
gacttcttcgacgccgggaccgccatcgcccatggcgaggcgatgctggaggccggcgcc
gacctgctggacgtcggcggcgaatccacccgtcccggttccgcccccgtgtcgccggag
gaggaggaggcccgcgtcctgccggtcgtccgccacttcgcggccaagggtgcggtggtg
tcggtggacacgcggcacgctcgggtgatgcgcgcggcgctcgacgccggggcggcgctg
atcaacgacgtggccgggctgcgcgaccccggcgcgctgcctctggtggcggagaaggcg
gcgcccgtggtcgtcatgcacatgcggggcgaacccggcaccatgcagcagaacccgacc
tatgaggacgcgacgctcgacgtgttcgactggttggaggagcgggtggaggcctgcctc
gccgccggggtggcgctggagcgcatcgccgtcgatcccggcatcggcttcggcaagacg
gtggaacacaatctcgacatcctgcgccacaccgccctttaccacgggctgggctgcgcc
ctgctgatcgggctgtcgcgcaagaccctgatcggcaagctgtcgcggagcgagccgccg
aaggaacgtctggccggatcgctgaccgggggtttggaaacgctgaaccagggcgcgcag
atcctgcgtgtgcatgacgttccccaaacgatccaggcgcgcgccgtctgggaggggctg
catcctgcaagggtgccgtga

DBGET integrated database retrieval system