KEGG   Azospirillum brasilense: AZOBR_100234Help
Entry
AZOBR_100234      CDS       T02152                                 

Gene name
matA
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
abs  Azospirillum brasilense
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:abs00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:abs00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1503412..1504977
Genome map
AA seq 521 aa AA seqDB search
MSETPEIKSAETRSSQPVPTQPPAIGVGTPPGLLDRTLDTLRAGWREIAASARGVVGAAP
RANLPKEDAERLKEQIEACLEGRGGEVSARARAAQLGRTYLALDGQGRRNFLMMLARDFD
VDRAAVDQAMATFQTAGDPVSRGHAERALRRALEPPRLRLLTQFNGLPEGVKFLVDLRAE
LMEMARGEPLLQALEDDLKSLLRSWFDVGFLEMRRITWDSPASLLEKLIKYEAVHEISGW
RDLKDRLDSDRRCFAFFHPRMPNEPLIFVEVALVQGMSDNVQALLDPSAPVCDPKSADSA
IFYSISNAQVGLAGISFGNFLIKRVVDGLTAEFPNIKCFATLSPIPSFRRWLDRELAERG
DSLLSPPEAERIAEAMASRPGASESEAEGGADERPVLAGALALPSWHADDELQKQLRGPL
MRLCAHYLTTARASDRRSERPGAAPARALDPVAHFHLSNGARMERLNWLGDRSPKGLRQS
CGMMINYRYKLGEIDANHEAYRGEGKVNASSSIRSLGKGGG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacgcccgagatcaaatccgctgagacccggtccagccagcccgtcccgacc
cagccccccgccatcggggtgggcacgccgccggggctgctcgaccgcaccctggacacg
ctgcgcgcgggctggcgcgagatcgccgcctccgcccgcggggtggtcggcgccgcgccg
cgcgccaatctgcccaaggaggacgcggagcggctgaaggaacagatcgaagcctgcctg
gagggccgcggcggcgaggtgtcggcgcgggcgcgggcggcgcagctcggccgcacctat
ctggcgctggacgggcaggggcggcgcaatttcctgatgatgctggcgcgcgatttcgac
gtggaccgcgctgccgttgaccaagcgatggcgaccttccagacggcgggcgacccggtg
tcgcgcggccacgccgagcgcgccctgcgacgggcgctggagccgccgcggctgcgcctg
ctgacccagttcaacggcctgccggaaggggtgaagttcctggtcgacctgcgcgccgag
ctgatggagatggcgcgcggcgaaccgctgctccaggcgctggaggacgatctcaagagc
ctgctgcgcagctggttcgatgtcggcttcctggagatgcgccggatcacctgggacagc
ccggcctcgctcctggaaaagctcatcaagtacgaggcggtgcacgagatcagcggttgg
cgggacctgaaggaccgcctcgactccgaccgccgctgcttcgcctttttccacccgcgc
atgccgaacgagccgctgatcttcgtcgaggtcgcgctggtccagggcatgtcggacaac
gtccaggcgctgctcgacccctccgccccggtctgcgacccgaagagcgcggacagcgcc
atcttctattccatctccaacgcccaggtcgggctggcgggaatcagcttcggcaacttc
ctcatcaagcgggtggtggacgggctgaccgccgagtttcccaacatcaaatgcttcgcc
accctgtcgccgattcccagcttccgccgctggctggaccgggaattggccgagcgcggt
gattctctgctcagcccgcccgaggcggaacgcatcgccgaagccatggccagccgtccg
ggcgccagcgaatcggaggcggaaggcggcgcggacgagcgtcccgtgctggccggagcc
ctggctctgccctcttggcacgccgacgacgagcttcaaaagcagttgcgcggcccgttg
atgcggctgtgtgcgcattacctgacgacggcgcgcgcgtcggaccgccgcagcgaacga
ccaggtgcggcgccggctcgggcgctcgatccggtcgcgcatttccacctcagcaacggc
gcccgcatggagcggctgaactggctgggcgatcggtcgcccaaggggttgcggcagtct
tgcgggatgatgatcaactaccgctacaagctgggggaaatcgacgccaaccacgaagcg
taccggggggagggcaaggtcaacgcctcctcctccatccggtcgctgggaaaggggggc
ggatga

DBGET integrated database retrieval system