KEGG   Azospirillum brasilense Sp245: AZOBR_100303Help
Entry
AZOBR_100303      CDS       T02152                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01130  Biosynthesis of antibiotics
abs01230  Biosynthesis of amino acids
Module
abs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOBR_100303 (trpC)
Enzymes [BR:abs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AZOBR_100303 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CCC97917
UniProt: G8AL05
Position
complement(1568785..1569573)
Genome map
AA seq 262 aa AA seqDB search
MSDVLTRICDDKRALVQARKSARPLSAVEDAARAADPARGFIRALRRTVDGGRYGLIAEI
KKASPSKGLIRPDFDPPSLARAYREGGATCLSVLTDEPYFQGCDDYLLAARAAVDLPVLR
KDFMVDPYQIAESRALGADCILIIMAALSDAQAAEIEGAAIAWGLDVLVEVHNREELDRA
LALKTPLLGVNNRNLKTLAVDIATTEELAAHVPADRMLVAESGLYSPADLSRMAAVGARC
FLVGESLMRQEDVTAATRALLA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtcctgacccgcatctgcgacgacaagcgcgcgctggtccaagcccgcaag
tccgcccgtccgctgtccgcggtggaggatgccgcccgcgccgccgacccggcgcgcggc
ttcatccgcgccctgcgccgcacggtggacgggggccgctacggcctgatcgccgagatc
aagaaggccagcccgtcgaagggcctgatccgcccggacttcgacccgccgtcgctggcg
cgcgcctaccgcgagggcggcgccacctgcctgtcggtgctgacggacgagccttacttc
cagggctgcgacgactatctgctggccgcccgcgccgcggtggacctgccggtgctgcgc
aaggacttcatggtcgatccctaccagatcgccgaatcccgcgcgctcggcgccgactgc
atcctgatcatcatggcagcgctgagcgacgcgcaggccgcggagatcgagggcgccgcc
atcgcctggggcctggacgtgctggtcgaggtgcacaaccgcgaggagttggaccgggcc
ttggcgctgaagaccccgcttctcggcgtgaacaaccggaacctgaagactctggcggtg
gacatcgccacgaccgaggaactggcggcccacgtgccagccgatcggatgctggtggcc
gaaagcggtctctacagcccggcggacctgtcgcgcatggcggctgtgggcgcgcgttgt
ttcctggtcggtgaatcgctgatgcggcaggaggatgtgaccgcggccacccgcgccctg
ctcgcctga

DBGET integrated database retrieval system