KEGG   Azospirillum brasilense Sp245: AZOBR_100314Help
Entry
AZOBR_100314      CDS       T02152                                 

Definition
triosephosphate isomerase (fragment)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_100314
   01230 Biosynthesis of amino acids
    AZOBR_100314
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_100314
   00051 Fructose and mannose metabolism
    AZOBR_100314
   00562 Inositol phosphate metabolism
    AZOBR_100314
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOBR_100314
Enzymes [BR:abs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AZOBR_100314
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AZOBR_100314
  Exosomal proteins of bladder cancer cells
   AZOBR_100314
  Exosomal proteins of melanoma cells
   AZOBR_100314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1579082..1579582
Genome map
AA seq 166 aa AA seqDB search
MLTDAGCRYVILGHSERRADHAESDAQVAAKAAAAHKAGLIAIICVGETEAQRDAGQANS
VVASQLKGSIPEGATAANTVIAYEPVWAIGTGKTATPDDVKAMHAHIRAELAGKTADPDA
VRVLYGGSVKPGNAAELMAVENVDGALVGGAALKADDFWAIATSCR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgacgccggctgccgctacgtcatcctcggccattcggagcgccgcgccgac
cacgccgaatccgacgcgcaggtcgccgccaaggccgccgccgcccacaaggcgggcctg
atcgccatcatctgcgtcggcgagacggaggcccagcgcgacgccgggcaggccaacagc
gtggtcgccagccagctcaagggttcgatcccggagggcgccaccgcggcgaacaccgtc
atcgcctacgagccggtctgggccatcggcaccggcaagaccgccacgcccgacgacgtc
aaggcgatgcacgcccacatccgggcggagctggccggcaagaccgccgatcccgacgcg
gtgcgggtcctctacggcggttcggtgaagccgggcaacgcggcggaactgatggcggtg
gagaatgtggacggcgcgctggtcggtggggccgcgctgaaggcggacgatttctgggcg
atcgccaccagttgccgctag

DBGET integrated database retrieval system