KEGG   Azospirillum brasilense: AZOBR_10090Help
Entry
AZOBR_10090       CDS       T02152                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abs  Azospirillum brasilense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AZOBR_10090 (folE)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AZOBR_10090 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87016..87681
Genome map
AA seq 221 aa AA seqDB search
MTASKTPHADNVLRGPGHPAGTGHGEIARPTRAEAEDAVRTLIRWAGDDPAREGLVGTPD
RVVRSYEEFFAGYAIDPEEILARTFEETDGYDEMVVLRDIRLESYCEHHMVPIIGKAHVA
YLPRQRVVGISKLARLVEAYAKRLQIQEKMTAQIANAIDQVLQPEGVAVVIEAQHQCMTT
RGVHKTGVTMVTSRMLGAFRSDPSTRREFLSMIGNPGSRAE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcttccaagactccgcacgccgacaatgtcctccgcggccccggccaccccgcc
ggcaccggccatggcgagatcgcgcgccccacccgtgccgaggccgaggacgccgtccgc
acactgatccgctgggctggcgacgatccggcgcgtgagggtctggtcggcacaccggac
cgggtggtccgctcctacgaggagttcttcgccggttacgccatcgacccggaggaaatc
ctcgcacgcaccttcgaggagaccgacggctacgacgagatggtcgtgctgcgcgacatc
cgtctggagtcctactgcgagcaccatatggtgccgatcatcggcaaggcgcacgttgcc
tacctgccccgccagcgcgtcgtcggcatctccaagctggcgcggcttgtcgaggcctac
gccaagcgcctgcaaatccaggagaagatgacggcgcagatcgccaacgccatcgatcag
gtgctccagcccgaaggcgtcgccgtggtgatcgaggcgcagcaccagtgcatgaccacc
cgcggcgtgcacaagaccggcgtcaccatggtgaccagccggatgctcggcgccttccgc
agcgatccgtccacccggcgcgagttcctgtcgatgatcggcaatcccggttcacgcgcg
gagtga

DBGET integrated database retrieval system