KEGG   Azospirillum brasilense Sp245: AZOBR_10095Help
Entry
AZOBR_10095       CDS       T02152                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AZOBR_10095
Enzymes [BR:abs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AZOBR_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(89933..90622)
Genome map
AA seq 229 aa AA seqDB search
MTVQANVLALVQEAMEARRSNEALDTPLDAAGEAAMIDAAARKVEELLDVLRIDHRNDHN
TRDTPRRVAKMLVRELLKGRFTAAPELTEFRNAEEFDHLIVTGPIAVRSTCAHHLMPIYG
TAFIGILPAKGGNILGLSKYDRIVDHFAARFQIQEELVKQIGNFIVEATRPRGLAVRISA
VHMCKTHRGVRAGHDSRMVNSSFHGEMLESRDLREEFLRECATLERSAR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgcaggcaaatgttctcgccctcgtgcaggaggcgatggaggcgcgccgctcg
aacgaggcgctcgacacgccgctggacgccgcgggcgaggcggccatgatcgacgccgcg
gcgcggaaggtcgaggaactgctcgacgtgctgcggatcgaccatcgcaacgaccacaac
acccgcgacacgccgcgtcgcgtcgccaagatgctggtgcgcgagcttctcaagggccgc
ttcacggcggcgcccgagctgaccgagttccggaacgccgaggaattcgaccatctgatc
gttaccggcccgatcgccgtgcgatcgacctgcgcgcaccatctgatgccgatctacggc
acggccttcatcggcatcctgccggccaagggcggcaacatcctgggcctgtccaagtac
gaccggatcgtcgaccatttcgccgcccgcttccagatccaggaggagctggtcaagcag
atcggcaatttcatcgtcgaggccacccggccgcgcgggctggccgtgcgcatcagcgcc
gttcacatgtgcaagacccaccgcggcgtgcgtgccggccatgacagccgcatggtcaac
agctccttccatggcgagatgctggaatcgcgcgatctgcgcgaggagttcctgagggag
tgcgcgacgcttgagcgttccgcccgctga

DBGET integrated database retrieval system