KEGG   Azospirillum brasilense: AZOBR_10095Help
Entry
AZOBR_10095       CDS       T02152                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abs  Azospirillum brasilense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(89933..90622)
Genome map
AA seq 229 aa AA seqDB search
MTVQANVLALVQEAMEARRSNEALDTPLDAAGEAAMIDAAARKVEELLDVLRIDHRNDHN
TRDTPRRVAKMLVRELLKGRFTAAPELTEFRNAEEFDHLIVTGPIAVRSTCAHHLMPIYG
TAFIGILPAKGGNILGLSKYDRIVDHFAARFQIQEELVKQIGNFIVEATRPRGLAVRISA
VHMCKTHRGVRAGHDSRMVNSSFHGEMLESRDLREEFLRECATLERSAR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgcaggcaaatgttctcgccctcgtgcaggaggcgatggaggcgcgccgctcg
aacgaggcgctcgacacgccgctggacgccgcgggcgaggcggccatgatcgacgccgcg
gcgcggaaggtcgaggaactgctcgacgtgctgcggatcgaccatcgcaacgaccacaac
acccgcgacacgccgcgtcgcgtcgccaagatgctggtgcgcgagcttctcaagggccgc
ttcacggcggcgcccgagctgaccgagttccggaacgccgaggaattcgaccatctgatc
gttaccggcccgatcgccgtgcgatcgacctgcgcgcaccatctgatgccgatctacggc
acggccttcatcggcatcctgccggccaagggcggcaacatcctgggcctgtccaagtac
gaccggatcgtcgaccatttcgccgcccgcttccagatccaggaggagctggtcaagcag
atcggcaatttcatcgtcgaggccacccggccgcgcgggctggccgtgcgcatcagcgcc
gttcacatgtgcaagacccaccgcggcgtgcgtgccggccatgacagccgcatggtcaac
agctccttccatggcgagatgctggaatcgcgcgatctgcgcgaggagttcctgagggag
tgcgcgacgcttgagcgttccgcccgctga

DBGET integrated database retrieval system