KEGG   Azospirillum brasilense Sp245: AZOBR_10100Help
Entry
AZOBR_10100       CDS       T02152                                 

Gene name
folM
Definition
dihydrofolate reductase folM
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
abs  Azospirillum brasilense Sp245
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AZOBR_10100 (folM)
   00670 One carbon pool by folate
    AZOBR_10100 (folM)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AZOBR_10100 (folM)
    1.5.1.-  
     AZOBR_10100 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(93530..94258)
Genome map
AA seq 242 aa AA seqDB search
MTASLLQDAVLVTGAGRRVGLHLAERMMALGHPVIAHYRTPTDGVERLRAAGAVCLQGDL
ADPDGGPRLAEAVRAVAGSLRAVIHNASAFEVTAPDTADALRQLDVFHAVHVRAPFALNR
ELAPLLDACSARRADIVHITDIYADNPNPAFDAYCASKAGLQNLALSFAKRLAPKVKVNV
VQPGPILFKEWHGPEARARVLSETLLGEEGGVEAIGMAVEAILRNHYQTGAVVAVDGGRR
LA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccctgttgcaggacgccgttctcgtcaccggcgcgggccgccgcgtcggt
ttgcatctggccgagcggatgatggcgctggggcaccccgtcatcgcccattaccgcacg
cccaccgacggtgtggaacggctgcgcgccgccggggcggtctgtctgcaaggcgatctg
gccgatccggacggcgggccgcggctggccgaggcggtgcgggccgtggcgggaagcctg
cgggcggtgatccacaacgcctcggccttcgaggtgacggcgccggacaccgcggacgcg
ctgcggcagctcgacgtcttccacgccgttcatgtgcgcgcgcccttcgcgctgaaccgc
gaactggcgccgctgctggacgcttgctcggcgcggcgggccgacatcgtccacatcacc
gacatctacgccgacaaccccaacccggccttcgacgcctattgcgccagcaaggccggg
ctccaaaacctcgcgctgtccttcgccaagcggctggcgcccaaggtgaaggtcaacgtc
gtccagccggggccgatcctgttcaaggagtggcacggcccagaggcgcgggcgcgtgtg
ctgtcagagacgctgctcggcgaagagggcggggtggaggccatcggcatggcggtggag
gccatcctccgcaaccactatcagaccggcgccgtcgtcgcggtggacggtggccggcgt
ctcgcctaa

DBGET integrated database retrieval system