KEGG   Azospirillum brasilense Sp245: AZOBR_10104Help
Entry
AZOBR_10104       CDS       T02152                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOBR_10104 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOBR_10104 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOBR_10104 (trpA)
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZOBR_10104 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(98646..99500)
Genome map
AA seq 284 aa AA seqDB search
MSALNDKAVDNGRIARRFAALKAEGRAGLVTFITAGDPDLETCRAVLHGLPAAGADLIEL
GLPFSDPMADGPAIQAASLRALHAGTTARKTLDLVRGFRETDADTPVILMGYYNPIHAYG
VDRFLADAIEAGVDGLIVVDLPPEEDEELCIPALKAGVNFIRLATPTTDDKRLPAVLQNT
SGFVYYVSIAGITGAASADNAAVGAAVERLKRHTDLPVAVGFGIKTPEQAADVARVADAA
VVGSAIVTRLAGGLDGGGKAPSGLAEDVLGFVRELADGVRGARG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccctcaacgacaaggccgttgacaatggccgcatcgcccggcggttcgccgcg
ctgaaggcggagggccgcgccggcctcgtcaccttcatcaccgccggcgacccggacctg
gagacctgccgcgccgtcctgcacggcctgcccgcggcgggcgccgacctgatcgagctg
gggctgcccttctccgacccgatggccgacggcccggcgatccaggcggccagcctgcgc
gcgctccacgccgggacgacggcgcgcaagacgctggacctcgtgcgcggcttccgcgaa
acggacgccgacacgccggtgatcctgatgggctattacaacccgatccacgcctatggg
gtggaccgcttcctggccgacgccatcgaggccggggtggacgggctgatcgtcgtcgac
ctgccgcccgaagaggacgaggagctgtgcatcccggcgctgaaggccggggtgaacttc
atccgcttggcgacgccgaccaccgacgacaagcgcctgccggcggttctccagaacacc
tcgggcttcgtctattacgtgtcgatcgccggcatcaccggtgctgccagcgccgacaac
gcggcggtgggcgccgcggtggaacgtctgaagcgccacaccgacctgccggtggcggtc
ggcttcggcatcaagacgccggagcaggcggccgatgtcgcccgcgtcgccgacgcggcg
gtggtcggctcggccatcgtcacgcggctggccggcggcctggacgggggcggcaaggcc
ccttcgggtctggccgaggatgtgctgggcttcgtccgggaactggccgacggcgtgcgc
ggcgcgcgcggttga

DBGET integrated database retrieval system