KEGG   Azospirillum brasilense: AZOBR_10104Help
Entry
AZOBR_10104       CDS       T02152                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abs  Azospirillum brasilense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abs01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:abs00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:abs00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(98646..99500)
Genome map
AA seq 284 aa AA seqDB search
MSALNDKAVDNGRIARRFAALKAEGRAGLVTFITAGDPDLETCRAVLHGLPAAGADLIEL
GLPFSDPMADGPAIQAASLRALHAGTTARKTLDLVRGFRETDADTPVILMGYYNPIHAYG
VDRFLADAIEAGVDGLIVVDLPPEEDEELCIPALKAGVNFIRLATPTTDDKRLPAVLQNT
SGFVYYVSIAGITGAASADNAAVGAAVERLKRHTDLPVAVGFGIKTPEQAADVARVADAA
VVGSAIVTRLAGGLDGGGKAPSGLAEDVLGFVRELADGVRGARG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccctcaacgacaaggccgttgacaatggccgcatcgcccggcggttcgccgcg
ctgaaggcggagggccgcgccggcctcgtcaccttcatcaccgccggcgacccggacctg
gagacctgccgcgccgtcctgcacggcctgcccgcggcgggcgccgacctgatcgagctg
gggctgcccttctccgacccgatggccgacggcccggcgatccaggcggccagcctgcgc
gcgctccacgccgggacgacggcgcgcaagacgctggacctcgtgcgcggcttccgcgaa
acggacgccgacacgccggtgatcctgatgggctattacaacccgatccacgcctatggg
gtggaccgcttcctggccgacgccatcgaggccggggtggacgggctgatcgtcgtcgac
ctgccgcccgaagaggacgaggagctgtgcatcccggcgctgaaggccggggtgaacttc
atccgcttggcgacgccgaccaccgacgacaagcgcctgccggcggttctccagaacacc
tcgggcttcgtctattacgtgtcgatcgccggcatcaccggtgctgccagcgccgacaac
gcggcggtgggcgccgcggtggaacgtctgaagcgccacaccgacctgccggtggcggtc
ggcttcggcatcaagacgccggagcaggcggccgatgtcgcccgcgtcgccgacgcggcg
gtggtcggctcggccatcgtcacgcggctggccggcggcctggacgggggcggcaaggcc
ccttcgggtctggccgaggatgtgctgggcttcgtccgggaactggccgacggcgtgcgc
ggcgcgcgcggttga

DBGET integrated database retrieval system