KEGG   Azospirillum brasilense Sp245: AZOBR_10105Help
Entry
AZOBR_10105       CDS       T02152                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00260  Glycine, serine and threonine metabolism
abs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01130  Biosynthesis of antibiotics
abs01230  Biosynthesis of amino acids
Module
abs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOBR_10105 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOBR_10105 (trpB)
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZOBR_10105 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCC96318
UniProt: G8AEF9
Position
complement(99497..100714)
Genome map
AA seq 405 aa AA seqDB search
MTRPNTYRSGPDERGHFGIYGGRFVAETLMPLILEVEKAYREARADPAFEGAIREQLKQY
VGRPNPLYYAERLTEKLGGAKIYFKREELNHTGAHKINNCIGQILLARRMGKKRIIAETG
AGQHGVATATVCALFDMPCVIYMGETDIARQQPNVFRMKLLGAEVVPVTSGARTLKDAMN
EALRDWVTNVADTYYLIGTAAGPHPYPAMVRDFQSVIGDEVRVQMQELEGRLPDSLVACV
GGGSNAIGLFHPFLDDPSVQMVAVEAAGHGIDKGPLAHAASITGGRPGVLHGNRTYLLQD
EDGQILEGHSISAGLDYPGVGPEHSWLHDIGRVEYVSATDQETLDAFQLCARTEGIIPAL
ESAHALAEIVKRAPKLPKDHLMVLCLSGRGDKDIFSVAQHLGVKL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacccaacacctaccgttccggtcccgacgagcgcgggcatttcggcatctat
ggcggacgcttcgtcgccgagacgctgatgcccctgatccttgaggttgagaaagcctac
cgcgaggcccgggccgatcccgccttcgagggcgcgatccgcgagcagctcaagcagtat
gtcggccgcccgaacccgctctactacgccgaacgcctgacggagaagctcggcggcgcg
aagatctacttcaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaactgc
atcggccagatcctgctcgcccgccgcatgggcaagaagcggatcatcgccgagacgggc
gccggccagcacggtgtggcgaccgccacggtctgcgcgctgttcgacatgccctgcgtc
atctacatgggcgagaccgacatcgcccgccagcagcccaacgtcttccgcatgaagctg
ctgggggcggaggtggttccggtgacctccggcgcgcggacgctgaaggacgcgatgaac
gaggcgctgcgcgactgggtcaccaacgtcgccgacacctactacctgatcggcaccgcc
gccggcccgcacccgtaccccgccatggtccgcgacttccagtcggtgatcggcgacgag
gtgcgcgtgcagatgcaggagctggagggccgcctgcccgacagcctcgtcgcctgcgtc
ggcggcggctccaacgccatcggcctgttccatcccttcctcgacgatccgtcggtgcag
atggtcgcggtcgaggccgccggccacggcatcgacaaggggccgctggcccacgccgcc
tcgatcaccggcgggcgccccggcgtcctgcacggcaaccgtacctacctgctccaggac
gaggacgggcagatcctggagggccactccatctccgccggcctcgactatccgggcgtc
gggccggagcattcctggctgcacgacatcgggcgcgtcgagtatgtctcggccaccgac
caggagacgctggacgccttccagctctgcgcccgcaccgagggcatcatccccgcgctg
gaatcggcgcacgcgctggcggagatcgtgaagcgcgccccgaaactgcccaaggaccac
ctgatggtgctctgcctgtcgggccgcggcgacaaggacatcttctccgtcgcccagcat
ctgggagtgaagctgtga

DBGET integrated database retrieval system