KEGG   Azospirillum brasilense Sp245: AZOBR_10105Help
Entry
AZOBR_10105       CDS       T02152                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOBR_10105 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOBR_10105 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOBR_10105 (trpB)
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZOBR_10105 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(99497..100714)
Genome map
AA seq 405 aa AA seqDB search
MTRPNTYRSGPDERGHFGIYGGRFVAETLMPLILEVEKAYREARADPAFEGAIREQLKQY
VGRPNPLYYAERLTEKLGGAKIYFKREELNHTGAHKINNCIGQILLARRMGKKRIIAETG
AGQHGVATATVCALFDMPCVIYMGETDIARQQPNVFRMKLLGAEVVPVTSGARTLKDAMN
EALRDWVTNVADTYYLIGTAAGPHPYPAMVRDFQSVIGDEVRVQMQELEGRLPDSLVACV
GGGSNAIGLFHPFLDDPSVQMVAVEAAGHGIDKGPLAHAASITGGRPGVLHGNRTYLLQD
EDGQILEGHSISAGLDYPGVGPEHSWLHDIGRVEYVSATDQETLDAFQLCARTEGIIPAL
ESAHALAEIVKRAPKLPKDHLMVLCLSGRGDKDIFSVAQHLGVKL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacccaacacctaccgttccggtcccgacgagcgcgggcatttcggcatctat
ggcggacgcttcgtcgccgagacgctgatgcccctgatccttgaggttgagaaagcctac
cgcgaggcccgggccgatcccgccttcgagggcgcgatccgcgagcagctcaagcagtat
gtcggccgcccgaacccgctctactacgccgaacgcctgacggagaagctcggcggcgcg
aagatctacttcaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaactgc
atcggccagatcctgctcgcccgccgcatgggcaagaagcggatcatcgccgagacgggc
gccggccagcacggtgtggcgaccgccacggtctgcgcgctgttcgacatgccctgcgtc
atctacatgggcgagaccgacatcgcccgccagcagcccaacgtcttccgcatgaagctg
ctgggggcggaggtggttccggtgacctccggcgcgcggacgctgaaggacgcgatgaac
gaggcgctgcgcgactgggtcaccaacgtcgccgacacctactacctgatcggcaccgcc
gccggcccgcacccgtaccccgccatggtccgcgacttccagtcggtgatcggcgacgag
gtgcgcgtgcagatgcaggagctggagggccgcctgcccgacagcctcgtcgcctgcgtc
ggcggcggctccaacgccatcggcctgttccatcccttcctcgacgatccgtcggtgcag
atggtcgcggtcgaggccgccggccacggcatcgacaaggggccgctggcccacgccgcc
tcgatcaccggcgggcgccccggcgtcctgcacggcaaccgtacctacctgctccaggac
gaggacgggcagatcctggagggccactccatctccgccggcctcgactatccgggcgtc
gggccggagcattcctggctgcacgacatcgggcgcgtcgagtatgtctcggccaccgac
caggagacgctggacgccttccagctctgcgcccgcaccgagggcatcatccccgcgctg
gaatcggcgcacgcgctggcggagatcgtgaagcgcgccccgaaactgcccaaggaccac
ctgatggtgctctgcctgtcgggccgcggcgacaaggacatcttctccgtcgcccagcat
ctgggagtgaagctgtga

DBGET integrated database retrieval system