KEGG   Azospirillum brasilense Sp245: AZOBR_10280Help
Entry
AZOBR_10280       CDS       T02152                                 

Gene name
paaF1
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00071  Fatty acid degradation
abs00280  Valine, leucine and isoleucine degradation
abs00281  Geraniol degradation
abs00310  Lysine degradation
abs00360  Phenylalanine metabolism
abs00362  Benzoate degradation
abs00380  Tryptophan metabolism
abs00410  beta-Alanine metabolism
abs00627  Aminobenzoate degradation
abs00640  Propanoate metabolism
abs00650  Butanoate metabolism
abs00903  Limonene and pinene degradation
abs00930  Caprolactam degradation
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01120  Microbial metabolism in diverse environments
abs01130  Biosynthesis of antibiotics
abs01212  Fatty acid metabolism
Module
abs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AZOBR_10280 (paaF1)
   00650 Butanoate metabolism
    AZOBR_10280 (paaF1)
  Lipid metabolism
   00071 Fatty acid degradation
    AZOBR_10280 (paaF1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZOBR_10280 (paaF1)
   00310 Lysine degradation
    AZOBR_10280 (paaF1)
   00360 Phenylalanine metabolism
    AZOBR_10280 (paaF1)
   00380 Tryptophan metabolism
    AZOBR_10280 (paaF1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZOBR_10280 (paaF1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZOBR_10280 (paaF1)
   00281 Geraniol degradation
    AZOBR_10280 (paaF1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZOBR_10280 (paaF1)
   00627 Aminobenzoate degradation
    AZOBR_10280 (paaF1)
   00930 Caprolactam degradation
    AZOBR_10280 (paaF1)
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AZOBR_10280 (paaF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCC96493
UniProt: G8AFE4
Position
complement(259724..260500)
Genome map
AA seq 258 aa AA seqDB search
MPYETILVETRGPVGLVTLNRPKALNALSDLLVTELGQALDALEADDSVGAIVVTGSEKA
FAAGADIKEMQNFSYMDVYKANFITAKWERLAKCRKPTIAAVAGYALGGGCELAMMADFI
LAADTAKFGQPEITIGTIPGAGGTQRLTRFVGKSKAMEMCLTGRLMDAAEAERAGLVSRV
VPAVDLVDEAVRVAEKIAKLSRPVVMMAKDAVNAAYETTMSEGIRVERRIFHATFAVEDQ
KEGMAAFAEKRQPDWKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgaaaccattctcgtcgaaacccgcggaccggtcgggctcgtcacgctgaac
cggcccaaggcgctgaacgcgctgtccgacctgctggtgaccgagctgggccaggcgctg
gacgcgctggaggccgacgactccgttggcgccatcgtggtcacgggttcggagaaggcc
ttcgccgccggcgccgacatcaaggagatgcagaacttctcctacatggacgtctacaag
gccaacttcatcaccgccaagtgggaacggctggccaagtgccgcaagccgaccatcgcc
gcggtcgccggctacgcgctgggcggcggctgcgaattggcgatgatggccgacttcatc
ctggccgccgacaccgccaagttcggccagccggagatcaccatcggcaccatccccggc
gccggcggcacgcagcgcctgacccgcttcgtcggcaagtccaaggccatggagatgtgc
ctgaccggtcgtctgatggacgccgccgaggccgagcgcgccggcctcgtcagccgcgtc
gtgcctgcggtggatctggtggacgaggcggtgcgggtcgccgagaagatcgccaagctc
tcgcgcccggtcgtcatgatggccaaggacgccgtcaacgccgcctatgagaccaccatg
tcggaaggcatccgggtcgagcgccgaatcttccacgccaccttcgccgtcgaagaccag
aaggaaggcatggccgccttcgccgagaagcgtcagccggattggaagcatcgctga

DBGET integrated database retrieval system