KEGG   Azospirillum brasilense: AZOBR_10280Help
Entry
AZOBR_10280       CDS       T02152                                 

Gene name
paaF1
Definition
enoyl-CoA hydratase-isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abs  Azospirillum brasilense
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AZOBR_10280 (paaF1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AZOBR_10280 (paaF1)
   00650 Butanoate metabolism
    AZOBR_10280 (paaF1)
  Lipid metabolism
   00071 Fatty acid degradation
    AZOBR_10280 (paaF1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZOBR_10280 (paaF1)
   00310 Lysine degradation
    AZOBR_10280 (paaF1)
   00360 Phenylalanine metabolism
    AZOBR_10280 (paaF1)
   00380 Tryptophan metabolism
    AZOBR_10280 (paaF1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZOBR_10280 (paaF1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZOBR_10280 (paaF1)
   00281 Geraniol degradation
    AZOBR_10280 (paaF1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZOBR_10280 (paaF1)
   00627 Aminobenzoate degradation
    AZOBR_10280 (paaF1)
   00930 Caprolactam degradation
    AZOBR_10280 (paaF1)
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AZOBR_10280 (paaF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(259724..260500)
Genome map
AA seq 258 aa AA seqDB search
MPYETILVETRGPVGLVTLNRPKALNALSDLLVTELGQALDALEADDSVGAIVVTGSEKA
FAAGADIKEMQNFSYMDVYKANFITAKWERLAKCRKPTIAAVAGYALGGGCELAMMADFI
LAADTAKFGQPEITIGTIPGAGGTQRLTRFVGKSKAMEMCLTGRLMDAAEAERAGLVSRV
VPAVDLVDEAVRVAEKIAKLSRPVVMMAKDAVNAAYETTMSEGIRVERRIFHATFAVEDQ
KEGMAAFAEKRQPDWKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgaaaccattctcgtcgaaacccgcggaccggtcgggctcgtcacgctgaac
cggcccaaggcgctgaacgcgctgtccgacctgctggtgaccgagctgggccaggcgctg
gacgcgctggaggccgacgactccgttggcgccatcgtggtcacgggttcggagaaggcc
ttcgccgccggcgccgacatcaaggagatgcagaacttctcctacatggacgtctacaag
gccaacttcatcaccgccaagtgggaacggctggccaagtgccgcaagccgaccatcgcc
gcggtcgccggctacgcgctgggcggcggctgcgaattggcgatgatggccgacttcatc
ctggccgccgacaccgccaagttcggccagccggagatcaccatcggcaccatccccggc
gccggcggcacgcagcgcctgacccgcttcgtcggcaagtccaaggccatggagatgtgc
ctgaccggtcgtctgatggacgccgccgaggccgagcgcgccggcctcgtcagccgcgtc
gtgcctgcggtggatctggtggacgaggcggtgcgggtcgccgagaagatcgccaagctc
tcgcgcccggtcgtcatgatggccaaggacgccgtcaacgccgcctatgagaccaccatg
tcggaaggcatccgggtcgagcgccgaatcttccacgccaccttcgccgtcgaagaccag
aaggaaggcatggccgccttcgccgagaagcgtcagccggattggaagcatcgctga

DBGET integrated database retrieval system