KEGG   Azospirillum brasilense: AZOBR_10498Help
Entry
AZOBR_10498       CDS       T02152                                 

Gene name
tesA
Definition
multifunctional: acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abs  Azospirillum brasilense
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:abs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466276..466971
Genome map
AA seq 231 aa AA seqDB search
MVRRHFNMALLRSGLAALAVVAAIGAGIGMTAPASAQTGAGKGPYTLLALGDSLTAGYGL
PEAQSFTPQLQAALREKGYDVTVVNAGVSGDTTAGGLSRLDWALADKPDAVLVELGANDM
LRGLDPTAARANLDAILKRLTGEKLPVLLAGMYASPSLGRAYMERFNAIYPDLAKAYDVQ
LYPFFLDGVAADAALNQPDGIHPNAAGVKVIVERITPHVARLLDGIAKSGD
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgccgccatttcaacatggccctccttcggtcggggctggccgctctcgccgtc
gttgcggcaatcggcgcgggaatcggcatgaccgcgcccgcgtccgcccagacgggtgcg
gggaaaggcccctacacccttctggcgctcggcgacagcctgaccgccggctacggcctt
cccgaagcgcagtccttcactccccagttgcaggcggcgctgagggagaaaggctacgac
gtcaccgtcgtcaacgccggcgtgtcgggcgacaccacggctggcggtctgtcgcggctc
gattgggcgctggccgacaagccggacgccgtgctggtggaactgggggcgaacgacatg
ctgcgcgggctcgaccccaccgctgcgcgcgccaacctcgacgccatcctgaagcggctg
accggcgagaagctgcccgtgctgctggccggcatgtacgcgtcgcccagcctgggccgc
gcgtacatggagcgcttcaacgccatctacccggatctggcgaaggcgtacgacgtacag
ctctacccgttcttcctggacggcgtggcggccgacgccgcgctgaaccagcccgacggc
atccatcccaacgcggccggcgtgaaggtgatcgtggagcgcatcacgccccacgtcgcc
cgccttctggacggcatcgccaaaagcggagactga

DBGET integrated database retrieval system