KEGG   Azospirillum brasilense Sp245: AZOBR_10498Help
Entry
AZOBR_10498       CDS       T02152                                 

Gene name
tesA
Definition
(GenBank) multifunctional: acyl-CoA thioesterase I/protease I/lysophospholipase L1
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AZOBR_10498 (tesA)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZOBR_10498 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AZOBR_10498 (tesA)
Lipid biosynthesis proteins [BR:abs01004]
 Fatty acid synthase
  Component type
   AZOBR_10498 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL SpoU_methylas_C OSK
Motif
Other DBs
NCBI-ProteinID: CCC96711
UniProt: G8AGZ2
Position
466276..466971
Genome map
AA seq 231 aa AA seqDB search
MVRRHFNMALLRSGLAALAVVAAIGAGIGMTAPASAQTGAGKGPYTLLALGDSLTAGYGL
PEAQSFTPQLQAALREKGYDVTVVNAGVSGDTTAGGLSRLDWALADKPDAVLVELGANDM
LRGLDPTAARANLDAILKRLTGEKLPVLLAGMYASPSLGRAYMERFNAIYPDLAKAYDVQ
LYPFFLDGVAADAALNQPDGIHPNAAGVKVIVERITPHVARLLDGIAKSGD
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgccgccatttcaacatggccctccttcggtcggggctggccgctctcgccgtc
gttgcggcaatcggcgcgggaatcggcatgaccgcgcccgcgtccgcccagacgggtgcg
gggaaaggcccctacacccttctggcgctcggcgacagcctgaccgccggctacggcctt
cccgaagcgcagtccttcactccccagttgcaggcggcgctgagggagaaaggctacgac
gtcaccgtcgtcaacgccggcgtgtcgggcgacaccacggctggcggtctgtcgcggctc
gattgggcgctggccgacaagccggacgccgtgctggtggaactgggggcgaacgacatg
ctgcgcgggctcgaccccaccgctgcgcgcgccaacctcgacgccatcctgaagcggctg
accggcgagaagctgcccgtgctgctggccggcatgtacgcgtcgcccagcctgggccgc
gcgtacatggagcgcttcaacgccatctacccggatctggcgaaggcgtacgacgtacag
ctctacccgttcttcctggacggcgtggcggccgacgccgcgctgaaccagcccgacggc
atccatcccaacgcggccggcgtgaaggtgatcgtggagcgcatcacgccccacgtcgcc
cgccttctggacggcatcgccaaaagcggagactga

DBGET integrated database retrieval system