KEGG   Azospirillum brasilense Sp245: AZOBR_120057Help
Entry
AZOBR_120057      CDS       T02152                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
abs  Azospirillum brasilense Sp245
Brite
Enzymes [BR:abs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AZOBR_120057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_PK Methyltransf_12 Methyltransf_32 PrmA Methyltransf_9 Methyltransf_24 MTS GidB DOT1 CMAS Methyltransf_4 N6_N4_Mtase Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: CCC98213
UniProt: G8ALV1
Position
1826102..1826758
Genome map
AA seq 218 aa AA seqDB search
MSEYAAARLNMVEGQIRPNKVTDQRLVDAMLDIPREQFVPKAARGIAYVDEDLAIGKGRY
LMEPMVFARMLQEVGIDATDVVLDIGSGSGYSTAVLARLAATVVGIESDAELAGQATEAL
TAVGADNAVIIAAPLAEGYPQQAPYDVIVIEGLVSEVPDGILAQLAEGGRLVSAVMGDRG
VGEVKLFQRSGGVTSARTLFEAHTHPLPGFEAKPKFVF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatacgccgccgcccgcctcaacatggtcgaagggcagatccgaccgaacaag
gtgaccgaccagcgtctggtcgacgccatgctcgacattccccgtgaacagttcgtgccg
aaggcggcgcgcggcattgcctatgtggacgaggatctcgccatcggcaaaggccgctat
ctgatggagccgatggtcttcgcccgcatgctccaggaagtgggcatcgacgcgaccgac
gtcgtgctcgacatcggcagcggctccggctactcgaccgccgtgctggcccgcctcgcc
gcgaccgtcgtcggcatcgagtccgacgccgagctggccgggcaggccacggaggcgctg
accgccgtcggtgccgacaacgccgtcatcatcgcggcgcccctcgccgagggctatccg
cagcaggccccttacgacgtgatcgtgatcgaaggcttggtgtcggaggtgccggacggc
atcctggcccagctggccgagggcgggcgtctggtgagcgccgtcatgggcgaccgtggg
gtgggcgaggtgaagctcttccagcgcagcggcggcgttacctcggcccgcacgctgttc
gaggcgcacacgcacccgctgcccggtttcgaagccaagccgaaattcgtattctga

DBGET integrated database retrieval system