KEGG   Azospirillum brasilense: AZOBR_140011Help
Entry
AZOBR_140011      CDS       T02152                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
abs  Azospirillum brasilense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AZOBR_140011 (ruvA)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AZOBR_140011 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1890513..1891142
Genome map
AA seq 209 aa AA seqDB search
MIAKLTGVVDSVGTDWVVVDVNGVGYQVACSNRTLSRMTVGERRALVVETFIRDDRITLY
GFADSGERDWFRLLTTIQGVGSRLALSILGVLDPDQLTRAIAAQDKTALTRADGVGPKVA
ARIVNELKDKVGNLTLGASAAAAPAAGGKAAPAAGGPDNMVMADAVSALVNLGYGRSEAF
GAVVAAGRKLGDGAGVSELIRHGLKELSQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaagctcaccggtgtcgtggattcggtcgggaccgactgggtggtggtggac
gtcaacggggtcggctaccaagtcgcctgctccaaccgcacgctgtcgcgcatgacagtg
ggggagcggcgggcgctggtcgtcgagaccttcatccgcgacgaccggatcaccctctat
ggcttcgccgattccggcgagcgcgactggttccggctgctgaccaccatccagggcgtc
ggctcgcgcctcgccttgtcgattctcggcgtgctcgacccggaccagctcacccgcgcc
atcgcggcgcaggacaagacggcgctcacccgcgccgacggcgtggggccgaaggtggcc
gcgcgcatcgtcaacgagttgaaggacaaggtgggcaacctcaccctcggcgcctcggct
gccgccgctccggcggcgggcggcaaggcggcgccggcggcgggcggccctgacaacatg
gtcatggcggacgccgtctcggccctcgtcaacctcggctacgggcggtcggaggcgttc
ggcgccgtcgtggccgccgggcgcaagctgggcgacggggccggcgtgtcggagctgatc
cgccatggcctcaaggaactcagccaatga

DBGET integrated database retrieval system