KEGG   Azospirillum brasilense: AZOBR_140103Help
Entry
AZOBR_140103      CDS       T02152                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abs  Azospirillum brasilense
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZOBR_140103 (cysQ)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AZOBR_140103 (cysQ)
Transfer RNA biogenesis [BR:abs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AZOBR_140103 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1972245..1973018)
Genome map
AA seq 257 aa AA seqDB search
MTDTAAASLLPKVRTIAHEAGQVILRFYNDGIDAATKVDGSPVTQADLAAEHVITPALHH
IAPGIPVVAEEAVAAGHRPDISGGRFWLVDPLDGTKEFISRNGEFTVNIALIDGGRPVLG
VVYAPATGDLYAACGAGTAVHWVEGRHDYPIQVRKPPPDGLTVVASRSHGSGSELDGFLA
GYTVKNRVTCGSSLKFCTVASGKADLYPRFGPTSEWDTAAGHAILAAAGGRVEQPDGSPF
LYGKADIVNPHFVAYGW
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgccgcggcaagcctgctgcccaaggtgcggaccatcgcccacgaagcg
ggtcaggtgatcctgcgcttctacaacgacggcatcgacgccgccacaaaggtcgacggc
agtccggtcacccaggccgatctggccgccgagcatgtcatcaccccggcccttcaccat
atcgcccccggcattccggttgtcgcggaggaggccgtggccgccgggcaccggccggac
atttccggcgggcggttctggctggtcgatccgctcgacggcaccaaggaattcatcagc
cgcaacggcgagttcaccgtcaacatcgccctgatcgacggcgggcgtccggtcctgggc
gtcgtctacgcgccggccaccggcgatctctacgccgcctgcggggccggcaccgccgtc
cattgggtggagggccgccacgactacccgatccaggtgcgcaagccgccgcccgacggg
ctgaccgtggtcgccagccgctcccacggcagcggcagcgaactggacggcttcctcgcc
ggctacacggtgaagaaccgggtgacctgcggcagctcgctgaaattctgcacggtggcc
tcgggcaaagccgacctctacccccgcttcggcccgaccagcgaatgggacaccgccgcc
ggccacgccatcctcgccgccgccggcgggcgggtggagcagcccgacggctcgcccttt
ctctacggcaaggccgacatcgtgaacccccatttcgttgcgtatggatggtga

DBGET integrated database retrieval system