KEGG   Azospirillum brasilense Sp245: AZOBR_140107Help
Entry
AZOBR_140107      CDS       T02152                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOBR_140107 (glgB)
Enzymes [BR:abs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AZOBR_140107 (glgB)
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOBR_140107 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1977838..1980102
Genome map
AA seq 754 aa AA seqDB search
MPNDIRTGNRAKAQEASPKAASPLSGGIEAIVHANHGDPFAILGMHQTGKDQPVEVRAFI
PGAEKLWVIDSASGDPVGEADKVHGEGFFVAVLTDRKEPFRYRLRVQFPLATVEFEDAYR
FWSVLGELDIHLLAEGTHLKSFERLGAHPREIDGVAGVAFAVWAPNARRVSVVGDFCDWD
GRRLPMRKRTEAGVWEIFVPHATVGQRYKFEIKGAGGDLLPLKSDPYAFQAEFRPQTASV
VHGLPSYDWQDAEWQRTRSASADLTAPISIYEVHLGSWARVPEEGDRFLTYRELADRLVP
YVKDLGFTHIELLPITEHPFDGSWGYQPIGMYAPTSRHGTPEDFKYFVDACHAAGIGLLL
DWVPGHFPTDPHGLGWFDGTHLYEHADPRQGYHQDWNTLIYNFGRTEVQNFLLGNALFWL
EHYRLDGLRVDAVASMLYLDYSRKAGEWVPNRFGGRENLESIAFLKRMNELTYGQNQGIM
TVAEESTAWPAVSRPVYLGGLGFGYKWNMGWMHDTLEYMAKDPIHRRYHHHQLTFGLIYQ
FSENFVLPLSHDEVVHGKGSLINKMPGDDWQKFANLRAYYGFMFAHPGKKLLFMGGEFGQ
WREWSEARSLDWHLLEEPLHQGLHALVRDLNGMYRGLKPLHQTDCDPAGFEWIEANDSDN
SVLAFLRKSGEDPEHHVVVVCNFTPMPRDGYRVGVTLPGRYEEVLNTDAPEYGGSGVGNA
GGVESEETEWHGRPHSITLTLPPLGTLVLERKVG
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgacatccgaacgggaaaccgtgccaaggcgcaggaagcgtcgccgaaggcc
gcgtcgccgttgagcggcggcatcgaggccatcgtccacgccaaccacggtgatcccttc
gcgatcctgggcatgcaccagaccggcaaggaccagcccgtcgaggtccgcgccttcatc
cccggcgcggaaaagctgtgggtgatcgacagcgcgtcgggcgacccggtgggcgaggcc
gacaaggtccatggcgagggcttcttcgtcgccgtcctgaccgaccgcaaggagcccttc
cgctaccgcctgcgcgtccagttcccgctggcgacggtggagttcgaggatgcctaccgc
ttctggtcggtcctgggcgaacttgacatccatctgctggccgagggcacgcacctcaag
agcttcgagcggctgggcgcccacccgcgggagatcgacggggtggccggcgtggccttc
gccgtctgggcgcccaacgcccggcgggtcagcgtcgtcggcgacttttgcgactgggac
ggtcgccgcctgcccatgcgcaagcggacggaggccggcgtgtgggagatattcgtgccc
cacgccaccgtcggccagcgctacaagttcgagatcaagggggcgggcggcgatctgctg
ccgctgaagtccgacccctacgccttccaggccgagttccgtccccagaccgcctccgtc
gtgcacggcctgccatcctacgactggcaggacgccgagtggcagcggacccgctccgcc
agcgccgacctgaccgctccgatctccatctacgaggtccatctcggctcctgggcgcgg
gtgccggaggaaggcgaccgcttcctcacctaccgggaactggccgaccggctggtgccc
tacgtgaaggatctgggcttcacccacatcgagctgctgccgatcaccgagcatcccttc
gacggctcctggggctaccagccgatcggcatgtacgcgccgaccagccgccacggcacg
ccggaggacttcaagtatttcgtggacgcctgccacgcggcggggatcgggttgctgctc
gactgggtccccggccatttcccgaccgatccgcacgggctgggctggttcgacggcacg
cacctctacgagcacgccgatccgcgccagggctatcaccaggactggaacacgctgatc
tacaatttcggccggacggaggtgcagaacttcctcctcggcaacgcgctgttctggctg
gagcattaccggctggacgggctgcgggtcgatgccgtggcctccatgctctacctcgac
tacagccgcaaggccggcgagtgggttccgaaccgcttcggcgggcgcgagaacctggaa
tccatcgccttcctgaagcggatgaacgaactgacctacggccagaaccagggcatcatg
acggtggccgaggaatccacggcttggccggcggtgtcgcggcccgtctatctcgggggc
ttgggcttcggctacaagtggaacatgggctggatgcacgacacgctggagtatatggcc
aaggaccccatccaccgccgctaccaccaccaccagctcaccttcggcctgatctaccag
ttctcggaaaacttcgtcctgccgctcagccacgacgaggtggtgcacggcaagggctcg
ctcatcaacaagatgccgggcgacgactggcagaagttcgccaacctgcgcgcctattac
ggcttcatgttcgcccatcccggcaagaagctgctgttcatgggcggcgagttcggccag
tggcgcgagtggagcgaggcgcgcagcctggactggcacctgctggaggagccgctgcac
caggggcttcacgcgctggtgcgcgacctgaacggcatgtaccgcggcctgaagccgctg
caccagaccgactgcgacccggcgggcttcgaatggatcgaggccaacgacagcgacaac
tccgtcctcgccttcctgcgcaagagcggggaggacccggagcaccatgtggtcgtggtc
tgcaacttcaccccgatgccgcgggacggctaccgcgtcggcgtcaccctgccgggccgc
tacgaggaggtgctgaacaccgacgccccggaatacggcggcagcggcgtcggcaacgcc
ggcggtgtagagagcgaggagacggagtggcatggccgtccgcattccatcaccctgacc
ctgccgccgctgggcacgctggtgctggagcgcaaggtggggtag

DBGET integrated database retrieval system