KEGG   Azospirillum brasilense: AZOBR_140112Help
Entry
AZOBR_140112      CDS       T02152                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (malQ-like)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
abs  Azospirillum brasilense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:abs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1984421..1986610
Genome map
AA seq 729 aa AA seqDB search
MSDLDRLAERLGIEPFYHDIWGNRRETSDATKRALSAAMGYPAGTGEELAASLHAVEDRT
WRRMLPPVLVIDEGAPLNLALAVPAGLEDAELTWTLTEEGGLAHRASLRVGNLPLAEQRV
LDGVAYERRTVSTRLPPTLPLGYHRLSVVIRPQGVGGTLEGGTVLIVAPQRCLTVEDVVP
GGRTWGIGLQLYALKSGDDWGIGDFDDLGRFAETAAGLGAGLVGLNPLHALFPADPNHIG
PYSPSSRTFLNSLYIDVERVPELAATPHAQALIASEEFRQRLAAARAMELVDYPAVSALK
MPVLEALHATFRALGESDARREAFETFRREMGEPLRRHAVFEALHEHFYRRDPSQWMWRT
WPPAFQHPDSPEVQAFAAEQAERVDFFEYLQWEADRQLGTAAERGRRAGLPIGFYRDLAV
AAHPGGAAAWGESDILVQGANVGAPPDQFNMKGQNWGLAPLSPVGLRESAYGSFIAMLRA
NMRHAGALRIDHVMALQHLFWIPADGSDGAYVEYPFEDLLRIIALESRRNGCIVIGEDLG
TVPEGFRPALERAGILSYRVLYFERSADGGFKAPDEYPAGAMVTVTTHDLATFKGFWTNR
DLDWRAKLDLYPDEAARNKDVWDRGVDRWWMLQALEREGLRPASYPNNEGSQPFSRELME
AVHRYLSRSPGRIAMVQIEDALGEVEQPNLPGTVDQHPNWRRRLGMPVEAMAGDEGLRRL
AEAVRSERS
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctcgaccggcttgccgaacggcttggcatcgagcccttctaccatgacatc
tggggcaaccggcgcgagacctccgacgcgacgaagcgggccttgtccgccgccatgggc
tatcccgccggcaccggcgaggaactggcggcgagcctgcacgcggtggaggaccggacg
tggcggcgcatgctgccccccgtcctggtgatcgacgagggcgcaccgctcaacctcgcc
ctggccgtcccggccggtctggaggacgccgagctgacctggacgctgaccgaggagggc
gggctcgcccaccgcgcgtcgctgcgcgtcggcaacctgccgctggccgagcagcgcgtg
ctcgacggcgtggcctacgagcggcggacggtttcgacccgcctgccgccgaccctgccg
ctcggctatcaccggctgtcggtggtgatccgtccccagggcgtgggtggtacgctggag
ggtggcacggtgctgatcgtcgccccgcagcgctgcctgacggtggaggacgtggttccc
ggcgggcggacctggggcatcggcctccagctctacgcgctgaagagtggtgacgactgg
ggcatcggtgacttcgacgacctcgggcgcttcgccgagacggcggcggggctcggcgcc
gggctggtcgggctcaacccgctgcacgcgctgttcccggccgaccccaaccacatcggc
ccctattcgccgagcagccggaccttcctcaacagcctctacatcgacgtggagcgggtg
cccgaactggcggccacgccgcacgcgcaggccctcatcgcgtcggaggagttccgccag
cggctggccgccgcgcgggcgatggaactggtggactatcccgccgtctccgccttgaag
atgccggtgctggaggcgctgcacgcgaccttccgtgcgctgggcgagagcgacgcgcgg
cgcgaggcgttcgagacgttccggcgcgaaatgggcgagccgctgcgccgccatgccgtg
ttcgaggcgctgcacgagcatttctaccgccgcgacccgtcccaatggatgtggcggacg
tggccgccggccttccagcacccggacagcccggaggtgcaggccttcgccgccgagcag
gccgagcgggtggatttcttcgagtatctgcaatgggaggccgaccgccagctgggcacg
gcggcggagcgcggacgacgggccgggctgcccatcggtttctaccgcgacctcgccgtg
gcggcgcatcccggcggggcggcggcctggggcgagtcggacattctggtgcagggggcc
aacgtcggcgcgccgccggaccagttcaacatgaaggggcagaactggggcctcgccccg
ctgtcgccggtgggcttgcgcgaatcggcttatggcagcttcatcgccatgctgcgcgcc
aacatgcgccacgccggggcgctgcgcatcgaccatgtgatggcgctgcagcacctgttc
tggattccggcggacggcagcgacggcgcctatgtcgagtacccgttcgaggacctgttg
cggatcatcgcgctggaaagccgccgcaatggctgcatcgtcatcggcgaggatctcggc
accgtgccggagggcttccgcccggcgctggagcgggccggcatcctcagctaccgcgtg
ctctatttcgagcgcagcgccgacggcgggttcaaggcgccggacgagtatccggccggg
gcgatggtcacggtgaccacccacgacctcgccaccttcaagggtttctggaccaaccgc
gacctcgactggcgcgccaaactggacctctatcccgacgaagcggcgcggaacaaggac
gtctgggaccgcggcgtggaccgctggtggatgcttcaggcgctggagcgggaagggctg
cgcccggccagctacccgaacaacgagggctcgcaacccttctcgcgcgagctgatggaa
gcggttcaccgctacctgtcccgctcgccgggccgcatcgccatggtgcagatcgaggat
gcgctgggggaggtggagcagccgaacctgccgggcaccgtggaccagcatcccaactgg
cgccgccgcctcggcatgccggtggaggcgatggccggggacgaagggctgcgccggctg
gccgaggcggtccgcagcgagcggtcctga

DBGET integrated database retrieval system