KEGG   Azospirillum brasilense Sp245: AZOBR_140132Help
Entry
AZOBR_140132      CDS       T02152                                 

Definition
(GenBank) putative diguanylate cyclase, GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
abs  Azospirillum brasilense Sp245
Brite
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AZOBR_140132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2004010..2005047
Genome map
AA seq 345 aa AA seqDB search
MAGEEDFETARILAVRAMDRIDANGLLPNPENFTLWYAYFGGQNPDLTRAIELAQRDGAT
LSQSHCDELYKRFFTLDAEAQAIRETSERARVALGRILDQLGSVGSETDRYGQALAGFRG
ELDQPMSLAELRAMVAAIAAETTAIADRQTRLQSQLLESSQQLAELRVVLDSARREAMTD
GLTGIANRRGFDLALVSAAEDAAQTGLPMTLLMVDIDHFKRFNDTHGHLVGDHVLKLVAK
VLTEGVKGRDTVARYGGEEFSVILPHTALANAIKLAEQLRASVGSRQIINRTRNATYGSV
TLSVGAAEYRPGEDLLALMRRADEALYTAKRGGRNRVCAEATVTG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgaagaggatttcgagacggcgcggattctcgctgtccgcgccatggatcgg
atcgacgccaatggattgttgccgaatccggagaatttcaccctctggtacgcctatttt
ggcggtcagaatccggacctgacgcgcgccatcgagctggctcagcgtgacggtgccacg
ctgtcgcaaagccattgcgacgagctgtacaaacgcttcttcacgctggatgccgaggcc
caggccatccgcgagacgtcggaacgggcgcgcgtcgccttgggccgcatcctcgaccag
ctgggcagcgtcggttcggagaccgaccgctacgggcaggcgctggccggcttccggggc
gagctggaccagccgatgagcttggccgagctgcgcgccatggtggcagccatcgcggcg
gagaccaccgccatcgccgatcgccagacccgcttgcagagccagcttctcgaatccagc
cagcaattggccgagctgcgcgtcgtcctggattcggcgcggcgggaggcgatgactgac
gggctgaccggaatcgccaaccggcgcggcttcgatctggcgctggtctccgccgcggag
gatgcggcgcagaccggattgccgatgacgctgctgatggtggacatcgaccatttcaag
cgcttcaacgacacccacggccatctcgtcggcgaccatgtgctgaaactggtcgccaag
gttttgaccgaaggggtgaaggggcgcgacaccgtcgcccgctacggcggggaggagttc
agcgtcatcctgccgcacaccgcgcttgccaacgccatcaagctggccgagcagcttcgc
gcctccgtggggtcgcggcagatcatcaaccggacgcgcaacgccacctacggttcggtc
accctgtcggtcggggcggccgaataccgccccggcgaggacctgctggctctgatgcgc
cgcgccgacgaggcgctctacaccgccaagcgcggcgggcgcaaccgcgtctgcgcggag
gccacggtgacgggctga

DBGET integrated database retrieval system