KEGG   Azospirillum brasilense Sp245: AZOBR_140132Help
Entry
AZOBR_140132      CDS       T02152                                 

Definition
putative diguanylate cyclase, GGDEF domain
Orthology
K13590  
diguanylate cyclase
Organism
abs  Azospirillum brasilense Sp245
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2004010..2005047
Genome map
AA seq 345 aa AA seqDB search
MAGEEDFETARILAVRAMDRIDANGLLPNPENFTLWYAYFGGQNPDLTRAIELAQRDGAT
LSQSHCDELYKRFFTLDAEAQAIRETSERARVALGRILDQLGSVGSETDRYGQALAGFRG
ELDQPMSLAELRAMVAAIAAETTAIADRQTRLQSQLLESSQQLAELRVVLDSARREAMTD
GLTGIANRRGFDLALVSAAEDAAQTGLPMTLLMVDIDHFKRFNDTHGHLVGDHVLKLVAK
VLTEGVKGRDTVARYGGEEFSVILPHTALANAIKLAEQLRASVGSRQIINRTRNATYGSV
TLSVGAAEYRPGEDLLALMRRADEALYTAKRGGRNRVCAEATVTG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgaagaggatttcgagacggcgcggattctcgctgtccgcgccatggatcgg
atcgacgccaatggattgttgccgaatccggagaatttcaccctctggtacgcctatttt
ggcggtcagaatccggacctgacgcgcgccatcgagctggctcagcgtgacggtgccacg
ctgtcgcaaagccattgcgacgagctgtacaaacgcttcttcacgctggatgccgaggcc
caggccatccgcgagacgtcggaacgggcgcgcgtcgccttgggccgcatcctcgaccag
ctgggcagcgtcggttcggagaccgaccgctacgggcaggcgctggccggcttccggggc
gagctggaccagccgatgagcttggccgagctgcgcgccatggtggcagccatcgcggcg
gagaccaccgccatcgccgatcgccagacccgcttgcagagccagcttctcgaatccagc
cagcaattggccgagctgcgcgtcgtcctggattcggcgcggcgggaggcgatgactgac
gggctgaccggaatcgccaaccggcgcggcttcgatctggcgctggtctccgccgcggag
gatgcggcgcagaccggattgccgatgacgctgctgatggtggacatcgaccatttcaag
cgcttcaacgacacccacggccatctcgtcggcgaccatgtgctgaaactggtcgccaag
gttttgaccgaaggggtgaaggggcgcgacaccgtcgcccgctacggcggggaggagttc
agcgtcatcctgccgcacaccgcgcttgccaacgccatcaagctggccgagcagcttcgc
gcctccgtggggtcgcggcagatcatcaaccggacgcgcaacgccacctacggttcggtc
accctgtcggtcggggcggccgaataccgccccggcgaggacctgctggctctgatgcgc
cgcgccgacgaggcgctctacaccgccaagcgcggcgggcgcaaccgcgtctgcgcggag
gccacggtgacgggctga

DBGET integrated database retrieval system