KEGG   Azospirillum brasilense Sp245: AZOBR_140281Help
Entry
AZOBR_140281      CDS       T02152                                 

Definition
acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AZOBR_140281
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AZOBR_140281
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AZOBR_140281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2133584..2134147
Genome map
AA seq 187 aa AA seqDB search
MARLSVYSDTDPTIAELSSADPALVTAHLALAGVLFERWPAPQAIPDSADAQAVLDAYSR
PVTALKEARGFQSADVVRMPRGQPDAAARRAAFLAEHTHEEDEARFFVQGSGAFYLHVDE
KVFRVVCGAGDLLSIPARTKHWFDMGPDPEFTAIRFFTRPDGWVATFTGDVIADRFPKFE
SETGCVV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtttgtccgtctacagcgacaccgatcccaccattgcggaactttcgtccgcc
gacccggcgctggtcaccgcccatctggcgctggccggcgtgttgttcgagcgctggccg
gcgccccaagccatccccgactccgccgacgcccaagcggttctggacgcctactccagg
ccggtgacggccctgaaagaggcgcgcggcttccagtccgccgacgtggtgcggatgcca
cgcggccagccggacgcggcggcccgccgcgccgccttccttgcggagcacacccacgag
gaggacgaggcccggttcttcgtgcagggaagcggcgctttctatctgcacgtggacgag
aaagtgttccgcgtcgtgtgcggggccggcgacctgctgagcataccggcgcggacgaag
cattggttcgacatggggccggacccggaattcaccgccatccgtttcttcacgcgcccg
gatggttgggtggcgaccttcaccggtgacgtgatcgccgaccgcttcccgaagttcgag
tcggaaaccggttgcgtcgtatga

DBGET integrated database retrieval system