KEGG   Azospirillum brasilense: AZOBR_140281Help
Entry
AZOBR_140281      CDS       T02152                                 

Definition
acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
abs  Azospirillum brasilense
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:abs00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2133584..2134147
Genome map
AA seq 187 aa AA seqDB search
MARLSVYSDTDPTIAELSSADPALVTAHLALAGVLFERWPAPQAIPDSADAQAVLDAYSR
PVTALKEARGFQSADVVRMPRGQPDAAARRAAFLAEHTHEEDEARFFVQGSGAFYLHVDE
KVFRVVCGAGDLLSIPARTKHWFDMGPDPEFTAIRFFTRPDGWVATFTGDVIADRFPKFE
SETGCVV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtttgtccgtctacagcgacaccgatcccaccattgcggaactttcgtccgcc
gacccggcgctggtcaccgcccatctggcgctggccggcgtgttgttcgagcgctggccg
gcgccccaagccatccccgactccgccgacgcccaagcggttctggacgcctactccagg
ccggtgacggccctgaaagaggcgcgcggcttccagtccgccgacgtggtgcggatgcca
cgcggccagccggacgcggcggcccgccgcgccgccttccttgcggagcacacccacgag
gaggacgaggcccggttcttcgtgcagggaagcggcgctttctatctgcacgtggacgag
aaagtgttccgcgtcgtgtgcggggccggcgacctgctgagcataccggcgcggacgaag
cattggttcgacatggggccggacccggaattcaccgccatccgtttcttcacgcgcccg
gatggttgggtggcgaccttcaccggtgacgtgatcgccgaccgcttcccgaagttcgag
tcggaaaccggttgcgtcgtatga

DBGET integrated database retrieval system