KEGG   Azospirillum brasilense: AZOBR_180228Help
Entry
AZOBR_180228      CDS       T02152                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
abs  Azospirillum brasilense
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:abs00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:abs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2703575..2703970
Genome map
AA seq 131 aa AA seqDB search
MRTVARTAARTAFAALVLLAAAPLPALADGDPANGEKLFRQCKACHTVEAEKNRVGPTLH
GLFGRKAGTVDTYANYSEGLKASGIAWDAKTLDPYLANPKAVIADSRMAFAGVAKPEDRA
DLIAYLEAATK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgtcgcccgcaccgccgcccgtacagcctttgccgccctggtccttctcgcc
gcggcaccgctcccggccctggccgacggcgatccggcgaacggcgagaagctgttccgc
cagtgcaaggcctgccatacggtggaggcggaaaagaaccgcgtcggcccgacgctgcac
gggctgttcgggcgcaaggccggcacggtggacacctacgccaactactccgaggggctg
aaggcctccggcatcgcgtgggacgccaagacgctcgacccctatctcgccaacccgaag
gcggtcatcgccgacagccgcatggccttcgccggggtcgcgaagccggaggaccgggcc
gacctgatcgcctatctggaagccgcgaccaagtga

DBGET integrated database retrieval system