KEGG   Azospirillum brasilense: AZOBR_200136Help
Entry
AZOBR_200136      CDS       T02152                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
abs  Azospirillum brasilense
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:abs01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:abs00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:abs00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:abs00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2933077..2933472)
Genome map
AA seq 131 aa AA seqDB search
MASNSKTLRSPLQIARGLGSAKHGTEHWWHQRVTAIALVPLTIWFVFGVIRHLGADHAAF
VAWLESPFSALMMVLTAVVTFHHAQAGLQVVIEDYVHNEMAKILSILAVKALCFVLGAAC
VIAVLKISFGA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacagcaagaccctccgctcgccgctgcagatcgcgcgcggcctgggctcc
gccaagcacggcaccgagcattggtggcaccagcgcgtcaccgccatcgccctggttccg
ctgaccatctggttcgtcttcggcgtgatccgccatctgggcgccgaccacgcggccttc
gttgcgtggctggagtcgcccttctcggcgctgatgatggtgctgaccgccgtggtcacc
ttccaccacgcccaggccgggctgcaggtggtgatcgaggactacgtgcacaacgagatg
gcgaagatcctgagcatcctggccgtgaaagccctgtgcttcgtgctgggtgccgcctgc
gtcatcgccgtcctcaagatttcgttcggagcctga

DBGET integrated database retrieval system