KEGG   Azospirillum brasilense Sp245: AZOBR_200136Help
Entry
AZOBR_200136      CDS       T02152                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
abs  Azospirillum brasilense Sp245
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_200136 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZOBR_200136 (sdhD)
   00650 Butanoate metabolism
    AZOBR_200136 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AZOBR_200136 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2933077..2933472)
Genome map
AA seq 131 aa AA seqDB search
MASNSKTLRSPLQIARGLGSAKHGTEHWWHQRVTAIALVPLTIWFVFGVIRHLGADHAAF
VAWLESPFSALMMVLTAVVTFHHAQAGLQVVIEDYVHNEMAKILSILAVKALCFVLGAAC
VIAVLKISFGA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacagcaagaccctccgctcgccgctgcagatcgcgcgcggcctgggctcc
gccaagcacggcaccgagcattggtggcaccagcgcgtcaccgccatcgccctggttccg
ctgaccatctggttcgtcttcggcgtgatccgccatctgggcgccgaccacgcggccttc
gttgcgtggctggagtcgcccttctcggcgctgatgatggtgctgaccgccgtggtcacc
ttccaccacgcccaggccgggctgcaggtggtgatcgaggactacgtgcacaacgagatg
gcgaagatcctgagcatcctggccgtgaaagccctgtgcttcgtgctgggtgccgcctgc
gtcatcgccgtcctcaagatttcgttcggagcctga

DBGET integrated database retrieval system