KEGG   Azospirillum brasilense Sp245: AZOBR_20019Help
Entry
AZOBR_20019       CDS       T02152                                 

Gene name
ccp
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
abs  Azospirillum brasilense Sp245
Brite
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AZOBR_20019 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524002..525006
Genome map
AA seq 334 aa AA seqDB search
MSMRAAVSFAAMLAASVATFGVPAFAADEPISPIEPAKVTNPGLVELGKKLYFDPRLSKS
GFISCNSCHNLSMGGTDNLKTSIGHNWQQGPINSPTVLNSSLNVAQFWDGRALTLQEQAG
GPIANPGEMGSTHALAVEVLRSIPEYQKEFGEVFGETKITIEEVTKAIAAFEETLVTPNS
RFDQWLKGDKKALTTVELEGYELFKDSGCTACHNGSAVGGNTFQKMGVVEPYKTNNPAEG
RIAVTKEEADRFNFKVPTLRNVALTYPYFHDGEAATLSDAVDVMGRIQLGKKFSPDENGK
IVAFLKTLTGDQPSFALPILPPSTDKTPKPHPFD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgcgtgctgccgtgtcgttcgcggccatgctggcggcctccgtcgccaccttc
ggcgtgccggcgttcgccgccgacgaaccgatttcgccgatcgagccggcgaaggtcacc
aatcccggattggttgaactcggcaagaagctgtacttcgatccccggctgtccaagtcc
ggcttcatctcctgcaactcgtgccacaacctgtccatgggcggcaccgacaacctgaag
acctccatcggccacaactggcagcagggcccgatcaactcgccgaccgttctgaactcc
agcctgaacgtggcgcagttctgggacggccgcgcgctgaccctgcaggagcaggccggc
ggcccgatcgccaaccccggcgagatgggctccacccacgccctggcggtcgaggtgctg
cgctccatccccgaataccagaaggaattcggtgaggtcttcggcgagaccaagatcacc
atcgaggaggtgaccaaggccatcgccgccttcgaggagacgctggtcacgccgaactcc
cgcttcgaccaatggctgaagggcgacaagaaggccctgaccaccgtcgagctggaaggc
tacgagctgttcaaggactcgggctgcaccgcctgccacaacggctcggccgtcggcggc
aacacctttcagaagatgggcgtcgtcgagccctacaagaccaacaaccccgccgagggc
cgcatcgcggtgaccaaggaggaggccgaccgcttcaacttcaaggttccgacgctgcgc
aacgtcgcgctgacctacccctacttccacgatggcgaggccgcgacgctgtccgacgcc
gtggacgtcatgggccgcatccagttgggcaagaagttctcgcctgacgagaacggcaag
atcgtcgccttcctgaagacgctgaccggtgaccagccgagcttcgctctgccgatcctg
ccgccgtcgacggacaagacgccgaagccgcatcccttcgactga

DBGET integrated database retrieval system