KEGG   Azospirillum brasilense: AZOBR_200207Help
Entry
AZOBR_200207      CDS       T02152                                 

Gene name
cheB
Definition
chemotaxis glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
abs  Azospirillum brasilense
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:abs02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:abs02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3001479..3002543
Genome map
AA seq 354 aa AA seqDB search
MTRSIRVVIVDDSSLMREMLKAVISDEPGIEVVGVARDPYEARDVIKRTNPDVVTLDVEM
PRMDGLSFLEKIMTLRPTPVVMVSSLTQEGSEATIRALEIGAVDCVAKPDGSEGHGFEAM
AHELVGKIRIAATARLSMRRPKPATSPLQTPRRAGSGTRLIAIGASTGGVERIRDVLAVM
PADCPPIVITQHMGPSYVPSFAARLDRISPPSVEVATQGARLVQGKVYIAPGDRHLVIIR
DPQGYSCHIQDGPAVSGHRPSVDVLFSSVAKAAGANAVGVILSGMGRDGASGMLAMRDAG
AYTIGEQESSCVVYGMPRAAREAGAVAVELPLAQIPAEMLRAFDAIGEHRTRAN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgacacgctccatccgcgtcgtgatcgtggacgacagcagcctgatgcgggagatgctg
aaggccgtcatctcggacgagcccggcatcgaggtggtcggcgtcgcccgcgacccctac
gaggcgcgggacgtcatcaagcggaccaacccggacgtcgtcacgctggacgtcgagatg
ccgcggatggacgggctgtccttcctggagaagatcatgacgctgcgcccgacgccggtc
gtcatggtctcctccctgacccaggaggggtcggaggcgacgatccgtgcgctggagatc
ggcgcggtggactgcgtggccaagcccgacggctcggagggccacggcttcgaggcgatg
gcgcacgagttggtcggcaagatccgcatcgccgccaccgcccgcctgtcgatgcggcgg
cccaagcccgcgacctcgcccctccagacgccgcgccgcgccgggtcgggcacccgcctc
atcgccatcggcgcctcgaccggcggggtggagcgcatccgcgacgtgctggcggtcatg
cccgccgactgcccgcccatcgtcatcacccagcatatgggtcccagctacgtccccagc
ttcgccgcccggctcgaccgcatctcgccgccgtcggtggaggtcgccacccagggcgcc
cggctggtccagggcaaggtctacatcgcccccggcgaccgtcatctggtgatcatccgc
gacccccagggctattcctgccacatccaggacgggccggcggtcagcggccaccgcccg
tcggtggacgtgctgttctcctccgtcgccaaggcggcgggggcgaacgcggtgggggtg
atcctgtccggcatgggccgcgacggggcgtcgggcatgctggcgatgcgcgacgcgggg
gcctataccatcggcgaacaggaatcgagctgcgtcgtctacggcatgccgcgcgccgcc
cgggaagccggggcggtcgccgtcgaactgccgctggcgcagataccggccgagatgctg
cgcgcgttcgacgccatcggcgaacaccgcacgcgcgcgaactga

DBGET integrated database retrieval system