KEGG   Azospirillum brasilense Sp245: AZOBR_40127Help
Entry
AZOBR_40127       CDS       T02152                                 

Gene name
mls
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_40127 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOBR_40127 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_40127 (mls)
Enzymes [BR:abs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZOBR_40127 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688825..690429
Genome map
AA seq 534 aa AA seqDB search
MATTISGLEILGPITPGVETILTPEALAFLAELEGRFGSERLRLLDVRTKRRALIDQGHR
PDFLPETRAIREADWTIAPLPHDLLDRRVEITGPVDRKMVINALNSGAKVFMADFEDSSC
PSWANLIEGQANLRDAVRRTIAFDDPVSGKKYRLNDKTAVLKVRPRGWHLAEKHVRFDGE
PVSGALFDFALYAFHNAQELLARGSGPYFYLPKLESHFEARLWNEVFSVAEDYLKIPHGS
IKATVLVETILAAFEMDEILYELRDHSAGLNCGRWDYIFSFIKTFRNDPAAVLPDRAEVT
MATPFLQSYSLLAVKTCHRRGAPAIGGMAAYIPVKDDPAANETAFSKVRADKEREVSNGH
DGTWVAHPGLVPVAREVFDAYMRKPNQIDRKRADVSVTAADLLAVPEGPKTERGLRNNVA
VAIGYLEAWLRGIGCVPLFNLMEDAATAEISRTQLWQWVHHRATLDDGRPVTMELVDETI
AEELAAWKARVGDRAFDHGLYEEAAVMLRDLVERDDFVDFLTLPAYDRIVAQGA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaccatctccgggcttgagatcctgggtccgatcacgccgggcgtcgagacg
atcctgacgccggaggcgctggccttcctggcggagctggaggggcggttcgggtcggag
cggttgcgcctgctcgacgtgcggaccaagcggcgggcgctgatcgaccagggccacagg
ccggacttcctgccggaaacccgcgccatccgtgaggctgactggaccatcgcgccgctg
ccgcacgacctgctcgatcgccgggtggagatcaccgggccggtggaccgcaagatggtc
atcaacgcgctgaattccggcgcgaaggtcttcatggcggatttcgaggattcgagctgc
ccgtcctgggccaacctgatcgaggggcaggccaacctgcgcgacgccgtgcgccggacc
atcgccttcgacgatcccgtgtcgggcaagaagtaccgtctgaacgacaagaccgccgtc
ctcaaggtccgcccgcgcggctggcatctggcggagaagcacgtccggttcgacggcgaa
ccggtgtccggcgcgctgttcgacttcgccctctacgccttccacaacgcgcaggagctt
ctggcccgcggctccggcccctacttctacctgccgaagctggaaagccatttcgaggcg
cggctgtggaacgaggtgttctcggtcgccgaggattatctcaagatcccgcacggctcg
atcaaggccacggtgctggtggaaaccatcctggccgccttcgagatggacgagatcctc
tacgagctgcgcgaccattccgccgggctgaactgcgggcgctgggactacatcttcagc
ttcatcaagaccttccgcaacgaccccgccgctgtcctgcccgaccgggcggaggtgacg
atggcgacgcccttcctgcagtcctacagcctgctggcggtcaagacctgccaccgccgt
ggcgccccggccatcggcggcatggccgcctacatcccggtgaaggacgatcccgcggcc
aacgagaccgccttctccaaggtccgcgccgacaaggagcgggaggtgtccaacggccat
gacggcacctgggtggcccaccccggcctcgtccccgtcgcgcgggaggtcttcgacgcc
tacatgcgcaaacccaaccagatcgaccgcaagcgcgccgacgtcagcgtgaccgccgcc
gacctgctggccgtcccggaggggccgaagacggagcgcggcctgcgcaacaacgtggcc
gtcgccatcggctatctggaggcgtggctgcgcggcatcggctgtgtgccgctgttcaac
ctgatggaggacgccgccaccgcggagatcagccgcacccagctctggcagtgggtccac
catcgcgccacgctggacgacgggcgcccggtgaccatggagctggtggacgagaccatc
gccgaggagctggccgcctggaaggcccgcgtcggcgaccgcgccttcgaccatggtctg
tacgaggaggccgcggtgatgctgcgcgacctcgtggagcgggacgacttcgtggatttc
ctgaccctgccggcctacgaccgcatcgtcgcgcagggggcgtga

DBGET integrated database retrieval system