KEGG   Azospirillum brasilense: AZOBR_40127Help
Entry
AZOBR_40127       CDS       T02152                                 

Gene name
mls
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
abs  Azospirillum brasilense
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:abs01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:abs00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:abs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688825..690429
Genome map
AA seq 534 aa AA seqDB search
MATTISGLEILGPITPGVETILTPEALAFLAELEGRFGSERLRLLDVRTKRRALIDQGHR
PDFLPETRAIREADWTIAPLPHDLLDRRVEITGPVDRKMVINALNSGAKVFMADFEDSSC
PSWANLIEGQANLRDAVRRTIAFDDPVSGKKYRLNDKTAVLKVRPRGWHLAEKHVRFDGE
PVSGALFDFALYAFHNAQELLARGSGPYFYLPKLESHFEARLWNEVFSVAEDYLKIPHGS
IKATVLVETILAAFEMDEILYELRDHSAGLNCGRWDYIFSFIKTFRNDPAAVLPDRAEVT
MATPFLQSYSLLAVKTCHRRGAPAIGGMAAYIPVKDDPAANETAFSKVRADKEREVSNGH
DGTWVAHPGLVPVAREVFDAYMRKPNQIDRKRADVSVTAADLLAVPEGPKTERGLRNNVA
VAIGYLEAWLRGIGCVPLFNLMEDAATAEISRTQLWQWVHHRATLDDGRPVTMELVDETI
AEELAAWKARVGDRAFDHGLYEEAAVMLRDLVERDDFVDFLTLPAYDRIVAQGA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaccatctccgggcttgagatcctgggtccgatcacgccgggcgtcgagacg
atcctgacgccggaggcgctggccttcctggcggagctggaggggcggttcgggtcggag
cggttgcgcctgctcgacgtgcggaccaagcggcgggcgctgatcgaccagggccacagg
ccggacttcctgccggaaacccgcgccatccgtgaggctgactggaccatcgcgccgctg
ccgcacgacctgctcgatcgccgggtggagatcaccgggccggtggaccgcaagatggtc
atcaacgcgctgaattccggcgcgaaggtcttcatggcggatttcgaggattcgagctgc
ccgtcctgggccaacctgatcgaggggcaggccaacctgcgcgacgccgtgcgccggacc
atcgccttcgacgatcccgtgtcgggcaagaagtaccgtctgaacgacaagaccgccgtc
ctcaaggtccgcccgcgcggctggcatctggcggagaagcacgtccggttcgacggcgaa
ccggtgtccggcgcgctgttcgacttcgccctctacgccttccacaacgcgcaggagctt
ctggcccgcggctccggcccctacttctacctgccgaagctggaaagccatttcgaggcg
cggctgtggaacgaggtgttctcggtcgccgaggattatctcaagatcccgcacggctcg
atcaaggccacggtgctggtggaaaccatcctggccgccttcgagatggacgagatcctc
tacgagctgcgcgaccattccgccgggctgaactgcgggcgctgggactacatcttcagc
ttcatcaagaccttccgcaacgaccccgccgctgtcctgcccgaccgggcggaggtgacg
atggcgacgcccttcctgcagtcctacagcctgctggcggtcaagacctgccaccgccgt
ggcgccccggccatcggcggcatggccgcctacatcccggtgaaggacgatcccgcggcc
aacgagaccgccttctccaaggtccgcgccgacaaggagcgggaggtgtccaacggccat
gacggcacctgggtggcccaccccggcctcgtccccgtcgcgcgggaggtcttcgacgcc
tacatgcgcaaacccaaccagatcgaccgcaagcgcgccgacgtcagcgtgaccgccgcc
gacctgctggccgtcccggaggggccgaagacggagcgcggcctgcgcaacaacgtggcc
gtcgccatcggctatctggaggcgtggctgcgcggcatcggctgtgtgccgctgttcaac
ctgatggaggacgccgccaccgcggagatcagccgcacccagctctggcagtgggtccac
catcgcgccacgctggacgacgggcgcccggtgaccatggagctggtggacgagaccatc
gccgaggagctggccgcctggaaggcccgcgtcggcgaccgcgccttcgaccatggtctg
tacgaggaggccgcggtgatgctgcgcgacctcgtggagcgggacgacttcgtggatttc
ctgaccctgccggcctacgaccgcatcgtcgcgcagggggcgtga

DBGET integrated database retrieval system