KEGG   Azospirillum brasilense: AZOBR_40272Help
Entry
AZOBR_40272       CDS       T02152                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
abs  Azospirillum brasilense
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:abs00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:abs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815905..816444
Genome map
AA seq 179 aa AA seqDB search
MSMEWNKIFGAVLLAGLIAMLAGFAAEVLVHPKTPEKPGYVVAMPDGAAPAPSGGAAPSG
PAEIAPLLAKADAAAGQSAAKACAACHSFDKGGPNKVGPNLYGIVGAPHGHLDGFAYSDA
IKGKAGPWNYDELNHFLYDPKAYAPGTKMTFAGVKKDQERANIIAYLRSLSDSPAPLPQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagtggaacaagattttcggcgccgtgctgctggcgggtctgatcgccatg
ttggccggcttcgccgcggaagttctggtgcacccgaagacgcctgagaaacccggctat
gtggtggccatgccggatggcgccgctcctgcccccagcggtggcgccgccccgtccggc
cccgccgagatcgccccgctgctcgccaaggccgacgccgccgccggccagtccgcggcc
aaggcctgcgccgcctgccacagcttcgacaagggcggcccgaacaaggtcggcccgaac
ctctacggcatcgtcggcgccccgcacggccatctggacggcttcgcctattccgacgcc
atcaagggcaaggccggcccctggaattacgacgagctgaaccacttcctctacgacccg
aaggcctacgcgccgggcaccaagatgaccttcgccggcgtgaagaaggatcaggaacgg
gcgaacatcatcgcctatctgcgctcgctgtccgacagcccggcgccgctgccgcagtaa

DBGET integrated database retrieval system