KEGG   Azospirillum brasilense Sp245: AZOBR_40272Help
Entry
AZOBR_40272       CDS       T02152                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
abs  Azospirillum brasilense Sp245
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZOBR_40272 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_40272 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815905..816444
Genome map
AA seq 179 aa AA seqDB search
MSMEWNKIFGAVLLAGLIAMLAGFAAEVLVHPKTPEKPGYVVAMPDGAAPAPSGGAAPSG
PAEIAPLLAKADAAAGQSAAKACAACHSFDKGGPNKVGPNLYGIVGAPHGHLDGFAYSDA
IKGKAGPWNYDELNHFLYDPKAYAPGTKMTFAGVKKDQERANIIAYLRSLSDSPAPLPQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagtggaacaagattttcggcgccgtgctgctggcgggtctgatcgccatg
ttggccggcttcgccgcggaagttctggtgcacccgaagacgcctgagaaacccggctat
gtggtggccatgccggatggcgccgctcctgcccccagcggtggcgccgccccgtccggc
cccgccgagatcgccccgctgctcgccaaggccgacgccgccgccggccagtccgcggcc
aaggcctgcgccgcctgccacagcttcgacaagggcggcccgaacaaggtcggcccgaac
ctctacggcatcgtcggcgccccgcacggccatctggacggcttcgcctattccgacgcc
atcaagggcaaggccggcccctggaattacgacgagctgaaccacttcctctacgacccg
aaggcctacgcgccgggcaccaagatgaccttcgccggcgtgaagaaggatcaggaacgg
gcgaacatcatcgcctatctgcgctcgctgtccgacagcccggcgccgctgccgcagtaa

DBGET integrated database retrieval system