KEGG   Azospirillum brasilense: AZOBR_40275Help
Entry
AZOBR_40275       CDS       T02152                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
abs  Azospirillum brasilense
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
819020..819613
Genome map
AA seq 197 aa AA seqDB search
MIGPEIERLIQLLSKLPGLGPRSARRAALHLMKRRDSLLVPLSESMALAAEAIRNCSVCG
NLDSRDPCSVCSDHSRDRSTICVVEDAGDLWALERTRAFHGTYHVLGGTLSALQGVGPDD
LNIPSLVERAKDPAVTEVILALNATVDGQTTAHVVTDRLSGSGVSVSRLAHGVPVGGELD
YLDDGTLTAALKARRPL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacctgaaatcgagcgcctgatccagctcctgtccaagctgccggggctgggg
ccgcggtcggcgcggcgggcggcgctgcacctgatgaagcgccgcgacagcctgctggtg
ccgctgtccgaatccatggcgctcgccgcggaggccatccgcaactgctcggtctgcggc
aaccttgacagccgcgatccctgctccgtctgttccgaccacagccgcgaccgctcgacc
atctgtgtggtggaggatgccggcgacctctgggcgctggagcgcacgcgcgcctttcac
ggcacctaccatgtcctgggtggcacgctgtcggccttgcagggggtggggccggacgat
ctgaacatcccgtccctggtggagcgcgcgaaggacccggcggtgaccgaggtcatcctg
gcgctgaacgccacggtggacgggcagacgaccgcccatgtggtgaccgaccgcctgtcc
ggcagcggggtttccgtgtcccgtctggcccatggcgtgccggtgggcggggaactggac
tatctggacgatgggactctgaccgcggcgctgaaggcgcggcggcctttgtaa

DBGET integrated database retrieval system