KEGG   Azospirillum brasilense: AZOBR_40323Help
Entry
AZOBR_40323       CDS       T02152                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
abs  Azospirillum brasilense
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abs01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:abs00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(861312..862520)
Genome map
AA seq 402 aa AA seqDB search
MKATMTVTTPSTAATATTTPKAETLSLLPTLLDARRLVVKIGSALLVDSATGRMRREWLD
ALADDVAACRKRGQEVVIVTSGAVACGREHLGLVGRALRLEEKQAAAATGQIRLAAAYQE
TLARHGLTVAQVLVTLEDTEERRRHLNGRATIDTLLKLGAVPVINENDTVATAEIRFGDN
DRLAARVAQMISADTLVLLSDIDGLYTADPRKDPDARHIPVVQELTSDIENMAGEPPPGY
SSGGMVTKIVAARVALAAGCRMVIAKGKRMNPLAALEQRPEQGGALCTWFLPAASPSSAR
KAWIGGNLNAHGALTVDAGALSALARGASLLPAGVRAVEGDFERGDVVVVKAPDGREVAR
GLTAYAAEDARRIAGRKSHEIEEILGYRGRDEMIHRDDLVVR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgacgatgacggtgacgacaccgagcacagcggcaacggcgacgacaacgcca
aaggctgagaccctctccctgcttcccaccctgctcgacgcgcggcggctggtcgtcaag
atcggctccgccctgctcgtcgacagcgccaccggccggatgcgccgcgagtggctggac
gcgctggccgacgacgtggccgcctgccgcaagcgcggccaggaggtggtgatcgtcacc
tccggcgcggtcgcctgcgggcgcgagcatctcggcctcgtcgggcgcgccctgcgtctg
gaggagaagcaggccgccgccgccaccggccagatccggctcgccgccgcctaccaggag
acgctggcccgccacgggctgaccgtcgcccaggtgctggtgacgctggaggacacggag
gagcgccgccgccacctcaacggccgcgccaccatcgacacgctgctgaagctgggcgcc
gtcccggtcatcaacgagaacgacacggtcgccacggcggagatccgcttcggcgacaac
gaccgtctggccgcccgcgtcgcccagatgatcagcgccgacacgctggtcctgctgtcg
gacatcgacggcctctacaccgccgacccgcgcaaggaccctgacgcccggcacatcccg
gtcgtccaggaactgacctccgacatcgagaacatggcgggcgagccgccgcccggctac
agctccggcgggatggtgaccaagatcgtcgcggcgcgcgtcgcgctggccgccggctgc
cgcatggtcatcgccaagggcaagcgcatgaacccgctggccgcgctggagcagcggccc
gagcagggcggcgccctgtgcacatggttcctgcccgccgcctccccctcctccgcccgc
aaggcgtggatcggcggcaacctgaacgcccacggcgcgctgacggtggacgccggcgcc
ctgtcggcgcttgcccgcggggccagcctgctgcccgccggggtgcgcgccgtcgagggc
gacttcgagcgcggcgacgtggtggtggtcaaggcgccggacgggcgcgaggtggcgcgc
ggcctgaccgcctacgccgccgaggacgcccgccgcatcgccggccgcaagagccacgag
atcgaggagatcctgggctaccggggccgcgacgagatgatccaccgcgacgatctggtg
gtgcggtga

DBGET integrated database retrieval system