KEGG   Azospirillum brasilense Sp245: AZOBR_70092Help
Entry
AZOBR_70092       CDS       T02152                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00010  Glycolysis / Gluconeogenesis
abs00052  Galactose metabolism
abs00500  Starch and sucrose metabolism
abs00520  Amino sugar and nucleotide sugar metabolism
abs00521  Streptomycin biosynthesis
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01120  Microbial metabolism in diverse environments
abs01130  Biosynthesis of antibiotics
abs01200  Carbon metabolism
Module
abs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_70092 (glk)
   00052 Galactose metabolism
    AZOBR_70092 (glk)
   00500 Starch and sucrose metabolism
    AZOBR_70092 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AZOBR_70092 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZOBR_70092 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AZOBR_70092 (glk)
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AZOBR_70092 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CCC97456
UniProt: G8AJP4
Position
complement(1145486..1146475)
Genome map
AA seq 329 aa AA seqDB search
MTADHTTNDRATVSGPVTLVADIGATNARFGLIDGTGIHGSRVLRCADFPSLEAAALAYL
GGVAHDARPSRGAFAIAGPVTGDAVLMTNRGWSFSTAEVRGKLGLERLAVINDFTAVALS
VPRLTAADVRQVGEGAPVPGRVVGVVGPGSGLGVSGLVPGAEGWTALAAEGGHVTMAPVS
DRESAVLAQLRKSFEHVSAERVLSGPGLVNLYQALCVLDHQEPEPFTPAQVSDAATANTN
PHCVEAVEMFCAMLGTVAGNLALTLGARGGIYIAGGIVPKLGTLFTHSRFRKRFMEKGRM
RDFLAPIPTYVITHELPAFLGLAEAAERA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagaccacaccaccaatgaccgcgccaccgtttccggccccgtcaccctggtc
gccgacatcggcgccaccaacgcccgcttcggcctgatcgacggcacgggcatccacggg
tcgcgcgtgctgcgctgcgccgacttcccgtcgctggaggcggcggcgctcgcctatctg
ggcggcgtggcccatgacgcccggcccagccgcggcgccttcgcgatcgccggcccggtg
accggcgacgcggtgctgatgaccaaccgcggctggtccttctccacggccgaggtgcgc
ggcaagctggggctggagcggctggccgtcatcaacgacttcaccgccgtcgccctgtcg
gtgccccgcctcaccgccgccgacgtccgtcaggtgggcgagggagcgccggtgccgggc
cgcgtcgtcggcgtggtcgggccgggcagcgggctgggcgtgtcggggctggtgcccggc
gccgagggctggaccgcgctggccgcggagggtggccacgtcaccatggcgccggtcagc
gaccgcgagagcgccgtcctggcccagctccgcaagagcttcgagcatgtgtcggcggag
cgggtgctgtccgggccggggctggttaacctctatcaggcgctgtgcgtcctcgaccac
caggagccggaacccttcaccccggcccaggtgtcggatgcggcgaccgccaacaccaat
ccccattgcgtggaggcggtggagatgttctgcgcgatgctcggcaccgtggcgggcaac
ctcgctttgacgctgggtgcgcgcggcggcatctacatcgcgggcggcatcgtgccgaaa
ctgggcaccctgttcacccactcccgcttccgcaagcgtttcatggagaagggccggatg
cgcgatttcctggcccccatcccgacctacgtcatcacccacgagcttcccgccttcctc
ggtctggccgaggccgcggagcgggcgtaa

DBGET integrated database retrieval system