KEGG   Azospirillum brasilense Sp245: AZOBR_70092Help
Entry
AZOBR_70092       CDS       T02152                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_70092 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_70092 (glk)
   00052 Galactose metabolism
    AZOBR_70092 (glk)
   00500 Starch and sucrose metabolism
    AZOBR_70092 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AZOBR_70092 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZOBR_70092 (glk)
   00524 Butirosin and neomycin biosynthesis
    AZOBR_70092 (glk)
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AZOBR_70092 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1145486..1146475)
Genome map
AA seq 329 aa AA seqDB search
MTADHTTNDRATVSGPVTLVADIGATNARFGLIDGTGIHGSRVLRCADFPSLEAAALAYL
GGVAHDARPSRGAFAIAGPVTGDAVLMTNRGWSFSTAEVRGKLGLERLAVINDFTAVALS
VPRLTAADVRQVGEGAPVPGRVVGVVGPGSGLGVSGLVPGAEGWTALAAEGGHVTMAPVS
DRESAVLAQLRKSFEHVSAERVLSGPGLVNLYQALCVLDHQEPEPFTPAQVSDAATANTN
PHCVEAVEMFCAMLGTVAGNLALTLGARGGIYIAGGIVPKLGTLFTHSRFRKRFMEKGRM
RDFLAPIPTYVITHELPAFLGLAEAAERA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagaccacaccaccaatgaccgcgccaccgtttccggccccgtcaccctggtc
gccgacatcggcgccaccaacgcccgcttcggcctgatcgacggcacgggcatccacggg
tcgcgcgtgctgcgctgcgccgacttcccgtcgctggaggcggcggcgctcgcctatctg
ggcggcgtggcccatgacgcccggcccagccgcggcgccttcgcgatcgccggcccggtg
accggcgacgcggtgctgatgaccaaccgcggctggtccttctccacggccgaggtgcgc
ggcaagctggggctggagcggctggccgtcatcaacgacttcaccgccgtcgccctgtcg
gtgccccgcctcaccgccgccgacgtccgtcaggtgggcgagggagcgccggtgccgggc
cgcgtcgtcggcgtggtcgggccgggcagcgggctgggcgtgtcggggctggtgcccggc
gccgagggctggaccgcgctggccgcggagggtggccacgtcaccatggcgccggtcagc
gaccgcgagagcgccgtcctggcccagctccgcaagagcttcgagcatgtgtcggcggag
cgggtgctgtccgggccggggctggttaacctctatcaggcgctgtgcgtcctcgaccac
caggagccggaacccttcaccccggcccaggtgtcggatgcggcgaccgccaacaccaat
ccccattgcgtggaggcggtggagatgttctgcgcgatgctcggcaccgtggcgggcaac
ctcgctttgacgctgggtgcgcgcggcggcatctacatcgcgggcggcatcgtgccgaaa
ctgggcaccctgttcacccactcccgcttccgcaagcgtttcatggagaagggccggatg
cgcgatttcctggcccccatcccgacctacgtcatcacccacgagcttcccgccttcctc
ggtctggccgaggccgcggagcgggcgtaa

DBGET integrated database retrieval system