KEGG   Azospirillum brasilense Sp245: AZOBR_70096Help
Entry
AZOBR_70096       CDS       T02152                                 

Definition
(RefSeq) malate synthase G (fragment)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_70096
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOBR_70096
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_70096
Enzymes [BR:abs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZOBR_70096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1151753..1153402)
Genome map
AA seq 549 aa AA seqDB search
MLDRAAPLSDGSHADAAGYTVDNGRLVVALKDGRSTGLAEPERLVGYNGAPSAPTAILLA
DNGLHMEIRIDRSHPIGKTDAAGVADLVLESALTTIQDCEDSVAAVDAEDKVLAYRNWLG
LMTGSLTASFPKGSGTVERRLNPDRSYTSRNGETITLPGRSLMLIRNVGHLMTNSAVLLK
DGSEAPEGILDGMITSLIALHDVKGARLNSRAGSVYIVKPKMHGPEEVAFADELFARVED
ALGIARNTLKMGIMDEERRTTVNLKECIRAAAARVVFINTGFLDRTGDEMHTAMEAGPMI
RKNDMKSSAWIKAYEDWNVDTGLLCGLKGHAQIGKGMWAMPDRMADMLAAKIVHPQAGAN
TAWVPSPTAATLHALHYHQVNVAARQEELARRERASLDAILTIPLADRPNWSEEEIQQEL
DNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLLHGITTEAQV
METMKRMAAVVDKQNAGDPLYRPMAADFDGSVAFQAACDLVFKGREQPNGYTEPVLHRRR
IEAKAKAAG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgaccgcgccgcgccgctgtccgacgggtcgcacgccgacgccgccggctacacg
gtggacaacggccgcctcgtcgtcgcgctgaaggacggccgcagcacgggtctggccgag
ccggagcgtctggtcggctacaacggcgcgccgtcggccccgaccgccatcctgctggcc
gacaacggcctgcacatggaaatccgcatcgaccgcagccaccccatcggcaagaccgac
gcggcgggcgtcgccgacctcgtgctcgaatccgccctgaccaccatccaggactgcgag
gattccgtcgccgccgtggatgccgaggacaaggtgctggcctaccgcaactggctgggc
ctgatgaccggcagcctgaccgccagcttccccaagggcagcggcacggtggagcgccgg
ctgaaccccgaccgcagctacaccagccgcaacggcgagacgatcaccctgccgggccgc
agcctgatgctgatccgcaacgtcggtcatctgatgaccaacagcgcggtcctgctgaag
gacggcagcgaggcgccggaaggcatcctcgacggcatgatcacctcgctgatcgcgctg
cacgacgtgaagggcgcccgcctcaacagccgcgccggctccgtctacatcgtgaagccg
aagatgcacgggccggaggaggtcgccttcgcggacgagctgttcgcccgcgtcgaggac
gcgctgggcatcgcgcgcaacacgctgaagatgggcatcatggacgaggagcgccgcacc
acggtgaacctcaaggagtgcatccgggccgcggcggcgcgcgtggtgttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatgcacaccgccatggaagccggcccgatgatc
cgcaagaacgacatgaagtcgtccgcctggatcaaggcctatgaagactggaacgtggac
accggcctgctctgcgggctgaagggccacgcccagatcggcaagggcatgtgggcgatg
cccgaccgcatggccgacatgctggccgccaagatcgtccacccgcaggccggcgccaac
accgcctgggtgccctcgcccaccgcggccacgctgcacgccctgcattaccatcaggtc
aacgtcgccgcccgccaggaggagctggcccgccgcgagcgcgccagcctggacgccatc
ctgaccatcccgctggccgaccgccccaactggtcggaggaggagatccagcaggagctg
gacaacaacgcccagggcatcctcggctatgtcgtgcgctggatcgaccagggcgtcggc
tgctccaaggtgccggacatcaacaatgtcgggctgatggaagaccgcgccaccctgcgc
atctccagccagcacatcgccaactggctgctccacggcatcaccaccgaggcgcaggtc
atggagacgatgaagcgcatggccgccgtggtggacaagcagaacgccggcgatccgctc
taccgcccgatggccgccgacttcgacggcagcgtcgccttccaggccgcctgcgacctc
gtcttcaagggccgcgagcagccgaacggctacaccgagccggtgctgcaccgccgccgc
atcgaagccaaggcgaaagccgccggctga

DBGET integrated database retrieval system