KEGG   Azospirillum brasilense: AZOBR_70096Help
Entry
AZOBR_70096       CDS       T02152                                 

Definition
malate synthase G (fragment)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
abs  Azospirillum brasilense
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:abs01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:abs00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:abs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1151753..1153402)
Genome map
AA seq 549 aa AA seqDB search
MLDRAAPLSDGSHADAAGYTVDNGRLVVALKDGRSTGLAEPERLVGYNGAPSAPTAILLA
DNGLHMEIRIDRSHPIGKTDAAGVADLVLESALTTIQDCEDSVAAVDAEDKVLAYRNWLG
LMTGSLTASFPKGSGTVERRLNPDRSYTSRNGETITLPGRSLMLIRNVGHLMTNSAVLLK
DGSEAPEGILDGMITSLIALHDVKGARLNSRAGSVYIVKPKMHGPEEVAFADELFARVED
ALGIARNTLKMGIMDEERRTTVNLKECIRAAAARVVFINTGFLDRTGDEMHTAMEAGPMI
RKNDMKSSAWIKAYEDWNVDTGLLCGLKGHAQIGKGMWAMPDRMADMLAAKIVHPQAGAN
TAWVPSPTAATLHALHYHQVNVAARQEELARRERASLDAILTIPLADRPNWSEEEIQQEL
DNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLLHGITTEAQV
METMKRMAAVVDKQNAGDPLYRPMAADFDGSVAFQAACDLVFKGREQPNGYTEPVLHRRR
IEAKAKAAG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgaccgcgccgcgccgctgtccgacgggtcgcacgccgacgccgccggctacacg
gtggacaacggccgcctcgtcgtcgcgctgaaggacggccgcagcacgggtctggccgag
ccggagcgtctggtcggctacaacggcgcgccgtcggccccgaccgccatcctgctggcc
gacaacggcctgcacatggaaatccgcatcgaccgcagccaccccatcggcaagaccgac
gcggcgggcgtcgccgacctcgtgctcgaatccgccctgaccaccatccaggactgcgag
gattccgtcgccgccgtggatgccgaggacaaggtgctggcctaccgcaactggctgggc
ctgatgaccggcagcctgaccgccagcttccccaagggcagcggcacggtggagcgccgg
ctgaaccccgaccgcagctacaccagccgcaacggcgagacgatcaccctgccgggccgc
agcctgatgctgatccgcaacgtcggtcatctgatgaccaacagcgcggtcctgctgaag
gacggcagcgaggcgccggaaggcatcctcgacggcatgatcacctcgctgatcgcgctg
cacgacgtgaagggcgcccgcctcaacagccgcgccggctccgtctacatcgtgaagccg
aagatgcacgggccggaggaggtcgccttcgcggacgagctgttcgcccgcgtcgaggac
gcgctgggcatcgcgcgcaacacgctgaagatgggcatcatggacgaggagcgccgcacc
acggtgaacctcaaggagtgcatccgggccgcggcggcgcgcgtggtgttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatgcacaccgccatggaagccggcccgatgatc
cgcaagaacgacatgaagtcgtccgcctggatcaaggcctatgaagactggaacgtggac
accggcctgctctgcgggctgaagggccacgcccagatcggcaagggcatgtgggcgatg
cccgaccgcatggccgacatgctggccgccaagatcgtccacccgcaggccggcgccaac
accgcctgggtgccctcgcccaccgcggccacgctgcacgccctgcattaccatcaggtc
aacgtcgccgcccgccaggaggagctggcccgccgcgagcgcgccagcctggacgccatc
ctgaccatcccgctggccgaccgccccaactggtcggaggaggagatccagcaggagctg
gacaacaacgcccagggcatcctcggctatgtcgtgcgctggatcgaccagggcgtcggc
tgctccaaggtgccggacatcaacaatgtcgggctgatggaagaccgcgccaccctgcgc
atctccagccagcacatcgccaactggctgctccacggcatcaccaccgaggcgcaggtc
atggagacgatgaagcgcatggccgccgtggtggacaagcagaacgccggcgatccgctc
taccgcccgatggccgccgacttcgacggcagcgtcgccttccaggccgcctgcgacctc
gtcttcaagggccgcgagcagccgaacggctacaccgagccggtgctgcaccgccgccgc
atcgaagccaaggcgaaagccgccggctga

DBGET integrated database retrieval system