KEGG   Azospirillum brasilense: AZOBR_70097Help
Entry
AZOBR_70097       CDS       T02152                                 

Gene name
recD
Definition
putative exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abs  Azospirillum brasilense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AZOBR_70097 (recD)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AZOBR_70097 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154153..1156363
Genome map
AA seq 736 aa AA seqDB search
MLGGMSISGHAPPAAGTPAREPLSGLVERVTFHSPETGFCVLRLKVRGQRDLVTLVGHAA
TIGAGEFVQASGVWVNDRNHGLQFKADFLRATPPTTVEGIEKYLGSGLIRGIGPVYAKKM
VKAFGEAVFDVIEQEPDRLRQVTGIGPKRAQRIIAGWADQKVIREIMIFLHSHGVGTSRA
VRIFKTYGPDAIRLITENPYRLARDIRGIGFKTADAVAARLGIEKTAMIRARAGIGYALA
EATDQGHCGVPVAELIPLAVKLLEIDASILETAAELERQDGAVVADSLGGEPCLFLASLY
RAEQAIAERLRRLAGGPVPWPEIDAEKAIPWVEAKAGITLAEGQREALRQAATSKLLVIT
GGPGVGKTTLVNSILTMLKAKGVSIALAAPTGRAAKRLSESTGLEARTIHRLLETDPQAG
GFKRDETNPLDCDLLVVDETSMVDVPLMNALLRAVPGRAALLLVGDVDQLPSVGPGQVLG
DVIGSGAVPVVRLTEIFRQAATSRIIVNAHRINAGQMPEIPKTGEDSDFYFVEAATPEAG
VAKLIEMVRDRIPRRFGADPVRDVQILCPMNRGGLGARSLNIELQRVLNPPGESRVERFG
WTFGPGDKVMQVENNYDKEVYNGDLGIVSAVDAEEGVLTATFDGRPVTYDFGELDEVVLA
YATTIHKSQGSEYPVVVIPVVTQHYTMLHRNLIYTGVTRGKRLVVMLGQRRALAMAVRGT
PGRRRWTKLGEWLAPL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtggcatgagcatatccggccatgcacccccggcggcgggcacgcccgcgcgg
gagccgctgtcggggctggtggagcgggtgaccttccacagcccggagacgggattctgc
gtgctgcggctgaaggtgcgcgggcagcgcgacctcgtcacgctggtcggccacgccgcc
accatcggcgcgggggagttcgtgcaggccagcggcgtctgggtgaacgaccgcaaccac
ggactccagttcaaggccgacttcctgcgcgccaccccgccgaccacggtggagggcatc
gagaagtatctcggctccggcctgatccgcggcatcgggccggtctacgccaagaagatg
gtcaaggccttcggcgaggcggtgttcgacgtgatcgagcaggagccggaccggctgcgg
caggtcaccggcatcgggccgaagcgggcgcagcgcatcatcgccggctgggccgaccaa
aaggtgatccgcgagatcatgatcttcctgcacagccacggggtcggcacctcgcgggcg
gtgcgcatcttcaagacctacgggccggacgccatccggctgatcaccgagaacccctac
cggctggcccgcgacatccgcggcatcggcttcaagacggcggacgcggtggccgcaagg
ctgggcatcgagaagaccgcgatgatccgggcgcgggccggcatcggctatgccctggcc
gaggcgaccgaccagggccattgcggcgtgccggtggccgagctgatcccgctggccgtg
aagctgctggagattgacgcctccatcctggagaccgcggcggaactggagcggcaggac
ggcgcggtggtcgccgacagcctgggcggggagccctgcctgttcctggccagcctctac
cgggcggagcaggccattgccgagcggctgcgtcggctggctggcggtcccgtgccctgg
ccggagatcgacgcggagaaggctattccctgggtcgaggcgaaagccgggatcacgctg
gccgaaggtcagcgggaggcgctgcgccaagcggcgacgtcgaagctgctggtcatcacc
ggcggcccgggggtcggcaagacgacgctggtgaacagcatcctgaccatgctgaaggcc
aagggcgtgtcgatcgcgctggccgcccccaccggccgtgccgccaagcggctgagcgag
agcaccggcctggaggcgcggaccatccaccgcctgctggagaccgatccgcaggccggc
ggcttcaagcgcgacgagaccaacccgctggactgcgacctgctggtggtggacgagacc
agcatggtcgacgtgccgctgatgaacgcgctgctgcgcgccgtcccggggcgggcggcg
ctgctgctggtcggcgacgtggaccagctgccctcggtcgggccggggcaggtgctgggc
gacgtgatcggctccggcgcggtgccggtggtccggctgaccgagatcttccggcaggcg
gcgaccagccgcatcatcgtcaacgcccaccgcatcaacgccggccagatgccggagata
ccgaagacaggggaggacagcgacttctacttcgtcgaggcggcgactccggaggccggt
gtggcgaagctgatcgagatggtgcgcgaccgcattccccgccgattcggcgccgacccg
gtgcgcgacgtgcagatcctctgtccgatgaaccgcgggggcctgggcgcgcgctcgctg
aacatcgaattgcagagggtgctgaacccgccgggcgagtcccgagtcgagcgattcggc
tggaccttcggtcccggcgacaaggtcatgcaggtcgagaacaactatgacaaggaggtc
tacaacggcgacctcggcatcgtatccgccgtcgacgccgaagaaggtgtgctgaccgcc
accttcgacggccgcccggtgacctatgacttcggagaattggacgaggtcgtcctggcc
tatgcgacgacgattcacaagagccaaggctccgaatacccggtggtcgtcattccggtg
gtgacccagcattacacgatgctccaccgcaacctgatttataccggcgtgacgcgaggc
aagcgcctggtggtcatgctcggccagcgccgcgcgctcgccatggcggtgcgtggaacg
ccggggcggcggcgctggacgaaactgggggaatggctggcgcctctatga

DBGET integrated database retrieval system