KEGG   Azospirillum brasilense: AZOBR_p1100037Help
Entry
AZOBR_p1100037    CDS       T02152                                 

Gene name
cheB1
Definition
chemotaxis glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
abs  Azospirillum brasilense
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:abs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_p1100037 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZOBR_p1100037 (cheB1)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZOBR_p1100037 (cheB1)
Two-component system [BR:abs02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZOBR_p1100037 (cheB1)
Bacterial motility proteins [BR:abs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZOBR_p1100037 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:893475..894575
Genome map
AA seq 366 aa AA seqDB search
MTGTRKIRVLVVEDSPVVQQLLAHVIGEDPRLELAGIAASGEQALRMVVSLKPDVVSLDI
RLPGIDGFAVTERLMREHPVPIVVVASDVRDLDIPMRALQAGALAVVEKPGSMARADYQT
VARHLCTQLTIMSQVKVIRQRGRPRNGDEEPVGTNGRRRGASVPMPPPLPPSVVKRQFRA
LGITASTGGPAALVKLLRGLPTNFPLPVFVVQHIGAPFVAGFASWLGSVTPLPVALASDG
PHRPGHVYVAPGELHLTAEPGGMRLVHGDPVCGQRPSGDVLFSSLASAFGAAAIGVLLTG
MGEDGARGLTAMHRAGAYTIAEHASTAVIHSMPGTAVRLGGVTEELPIDKVAARLLELVS
TGVEPS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcacccgcaagatccgcgtcctggtggtggaggactcgccggtcgtccagcag
ctcctcgcccacgtcatcggcgaggacccgcggcttgagctggccggcatcgccgcgtcg
ggcgagcaggcgctgcgcatggtcgtctcgctgaagccggacgtggtgtcgctggacatc
cgcctgccggggatcgacggcttcgccgtgaccgagcggctgatgcgcgagcatcccgtg
cccatcgtcgtcgtcgcctccgacgtgcgcgacctggacatcccgatgcgggcgctccag
gccggggccctggccgtggtggaaaagccgggcagcatggcccgcgccgactatcagacc
gtcgcccgccatctctgcacccaactcaccatcatgagccaggtcaaggtgatccggcag
cgcgggcgcccgcgcaacggcgacgaggagcccgtcggcaccaacggccgccgcaggggt
gccagcgtcccgatgccgccgcccctgccgccgtccgtggtgaagcggcagttccgcgcg
ctggggatcaccgcctcgacgggcgggccggcggcgctggtgaagctgctgcgcgggctg
ccgaccaacttccccctgcccgtcttcgtcgtgcagcacatcggcgcgcccttcgtggcc
ggcttcgcctcctggctggggtcggtcacgccgctgccggtggcgctggcctccgacggg
ccgcaccggcccggccacgtctatgtcgcccccggcgagcttcatctgaccgccgagccc
ggcgggatgcggctggtccacggcgatccggtctgcggccagaggccgtccggggacgtg
ctgttctcctccctggcctcggccttcggcgccgccgccatcggcgtgctgctgaccggc
atgggagaggacggggcgcgcggcctcaccgccatgcaccgggcgggtgcctacaccatc
gcggagcacgcctccaccgcggtcatccacagcatgccggggaccgcggtccggctggga
ggcgttaccgaggagctgcccatcgacaaggtggcggcccgtttgctggaactggtttcg
acgggagtggagccctcatga

DBGET integrated database retrieval system