KEGG   Azospirillum brasilense Sp245: AZOBR_p110118Help
Entry
AZOBR_p110118     CDS       T02152                                 

Gene name
cycA
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
abs  Azospirillum brasilense Sp245
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZOBR_p110118 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_p110118 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(110471..110851)
Genome map
AA seq 126 aa AA seqDB search
MNKHILGAALIAGIAMGAGAAQAADAAAGKDVFKQCMACHTAEQGKNKVGPSLFGVVGRP
AASIDGFKYSKPMQEKAAGGLTWTPDNLKAYITAPKEVVPGGTMAFAGIKDAGKVDDLVA
FLAEQK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcatatcctgggcgccgccctgatcgccggcattgccatgggcgcgggcgcc
gcgcaggccgctgacgccgccgccggtaaggacgtcttcaagcagtgcatggcctgccac
accgccgagcagggcaagaacaaggtcggcccgtcgctgttcggcgtcgttggccgcccg
gccgcctcgatcgacggcttcaagtactccaagccgatgcaggagaaggccgccggtggt
ctgacctggaccccggacaacctgaaggcctacatcaccgccccgaaggaagtcgttccg
ggtggcacgatggccttcgccggtatcaaggacgccggcaaggtggacgatctggtcgcc
ttccttgccgagcagaagtaa

DBGET integrated database retrieval system