KEGG   Azospirillum brasilense: AZOBR_p110121Help
Entry
AZOBR_p110121     CDS       T02152                                 

Gene name
folK
Definition
7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abs  Azospirillum brasilense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:112441..112947
Genome map
AA seq 168 aa AA seqDB search
MTTVYLALGSNLGDRAANLATAQRRLSPQVQVTLASPVYETAPMYVTDQPSFLNMVLRAQ
TALGPWELLRHIKDIEAEMGRDLKGGLRFGPRPIDIDILLYGELVMYAPELEIPHPRIAE
RAFVLAPLADIAGGLQHPAIARSFDDLLAAVPGRDTVVRTGTELPVAV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggtctaccttgcgcttggcagcaatcttggcgatcgcgccgccaatctggcg
accgcgcaacgccggctctctccgcaggtccaggtcacgctggcctcgcccgtctacgaa
accgccccgatgtacgtgaccgaccagccgtctttcctgaacatggtgctgcgcgcgcag
acggcgctcggcccgtgggagcttctccgccacatcaaggacatcgaggcggagatgggt
cgcgacctgaaaggcggcctccgcttcgggccgcgccccatcgacatcgacatccttctc
tacggcgagttggtgatgtacgcgccggaactggagattccccatccccgcatcgccgag
cgcgcctttgtcctggccccgttggccgacatcgcgggcggccttcagcacccggccatc
gcgcgcagcttcgatgatcttctggctgccgtaccgggccgcgacacggtggtccgcacc
ggcacggagcttccggtggcggtctga

DBGET integrated database retrieval system