KEGG   Azospirillum brasilense: AZOBR_p1110013Help
Entry
AZOBR_p1110013    CDS       T02152                                 

Definition
putative acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abs  Azospirillum brasilense
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOBR_p1110013
  Amino acid metabolism
   00300 Lysine biosynthesis
    AZOBR_p1110013
Enzymes [BR:abs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AZOBR_p1110013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:974068..975351
Genome map
AA seq 427 aa AA seqDB search
MPLDHRESLFRRIAARRDELVALTRDLIRIPTVNPPGDVYTDCAEFLGRRLAGRGFAVEY
VRADGAPGDSDRYPRTNVIARVEGREPGPCVHFNGHIDVVPAGQGWTVDPFEGVVKDGRV
YGRGACDMKGGIAASIIAVEAILEAGIPFPGALEISGTVDEESGGYGGVGHLATLGYFSR
PRVDHVIIPEPLNVDRVCIGHRGVWWAEIETKGRVAHGSMPFLGNCAVRHMGAVLHRIET
ELIPRLAAKRTAMPVVPEGARQSTLNINAIHGGQPEDHGGLPSPMVPDRCRMVIDRRYLI
EEDPEEVRAEIVGILEDLRRERPGFDYELREVLAFLPTLTDADAPVVRAVGAAIETVLGR
PAAQVVSPGTYDQKHIARVGHLKDCIAYGPGILDLAHQPDEYVGIDDMVHSAQVMAMAAL
SLLRREV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgaccaccgggagtcgctgttccgccgcatcgcggcgcggcgcgacgagctt
gtcgcgctgacccgcgacctgatccgcattccgaccgtgaacccgcccggcgacgtctat
accgactgcgcggagttcctcgggcggcggctggccgggcgcggcttcgccgttgagtat
gtgcgggccgacggggcgccgggcgacagcgaccgctacccgcgcaccaacgtcatcgcc
cgcgtcgaggggcgtgagcccggcccctgcgtgcacttcaacggccacatcgacgtggtg
cccgccggccagggctggacggtcgatcccttcgaaggcgtcgtaaaggacgggcgcgtc
tatggccgcggcgcctgcgacatgaagggcggcatcgccgcgtcgatcatcgccgttgag
gcgatcctggaggcgggcatcccctttcccggcgcgctggaaatctccggcacggtggac
gaggagtccggcggctacggcggggtcgggcatctcgccacgctcggctatttctcccgc
ccgcgagtcgatcacgtcatcattccggagccgctgaacgtcgaccgcgtgtgcatcggc
caccgcggcgtctggtgggcggagatcgagacgaagggtcgggtcgcccacggttccatg
cccttcctcggcaactgcgcggtgcgccacatgggcgccgtgctgcaccggatcgagacg
gagctgatcccccgcttggccgccaagcgcaccgccatgccggtggtcccggaaggggcg
cggcaatccaccctgaacatcaacgccatccacggcggccagccggaggaccatggcggc
ttgcccagcccgatggtgcccgaccgctgccgcatggtcatcgaccgccgctacctgatc
gaggaggacccggaggaggtgcgggcggagatcgtcggcatcctggaggatctgcgccgc
gagcgccccggcttcgactatgagctgcgcgaggtgctggccttcctgcccaccctgacc
gacgccgacgcgccggtggttcgggcggtgggggcggccatcgagacggtgctgggccgc
ccggcggcgcaggtggtgtcccccggcacctacgaccagaagcacatcgcgcgggtcggg
catctcaaggactgcatcgcctacggccccggcatcctcgacctcgcccaccagccagac
gagtatgtgggcatcgatgacatggtccattccgcccaggtgatggcgatggccgccctg
tctttgctgcggcgggaggtgtag

DBGET integrated database retrieval system