KEGG   Azospirillum brasilense: AZOBR_p1110164Help
Entry
AZOBR_p1110164    CDS       T02152                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
abs  Azospirillum brasilense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:abs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(1120995..1123472)
Genome map
AA seq 825 aa AA seqDB search
MATTTTGLVDTTFVVNASGQAAGGIWPQFRLLLDGVNLGQATVSSTSDGRYTFKAQVAPD
QAHKLQIVYFNDGYVNGQDRNLLVKSLEVNGKPVASTSSLVTYDRGASDGKDVIPGQEGM
WWDGSLDFALTKDYFPVPTPPAPAGNTQVILNLQGNAAGGVNAHFNLLIDGKKVGEGVAG
TSAKDYAFSINATADQAHKVQIQYDNDATVNGQDRNLLVNKITINGKSVMPTDSNVTYDK
GALDGKDVVKGQSGMWWNGTLVVDADKSFFPGSSNPTTPTNPPAPTPTKPTLSVSDVSVT
EPTGKTTGIAPGFLHTEGGQIMDSSGKAVKLTGVNWFGSEGYAFAPQGLWMDSYQSHMNQ
MKDLGFNTIRLPYSDAMLDNGRMPTGIDYSKNPDLRGKTSLEVFDKIIDYADKIGMKIIL
DHHRSGDGASANENGLWYTSQYPESKMIENWKMLATRYKGNDAVIGADLHNEPHNPATWG
DGGPNDWARAAERIGNAIQSVNKDWLLIVEGIETYQNQWYWWGGNLLGEKNYEVKFNEPG
KLVYSVHDYGPSLYMMDWFKANNFPNNMPAKWDQMWGHFIQNDETPILVGEFGSRMETAI
DKAWMPKLIQYMNGDWNGDGKIDLAAGDQGASWTYWAWSPGSGDTGGIMNDSWKVDYNKY
NAIKPGLYSSTAASPVTTDAVFTVKLSQAYNQTVTVDYATADGTAKAGSDYLATSGKLTF
AAGETTKTVAVKVLSDDVAEGVETFNLKLSNPTQATIADGTGIGTINPPGSAQALSADML
AHSLAQDTATVQSVGVQSALDLSSVDFTHMMTVDAVNLMLEHQAA
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaccaccacgggtctcgtcgacacgaccttcgtcgtcaacgcctcggggcag
gctgccggcgggatctggccgcagttccggctgctcctggatggtgtcaaccttggccag
gcgacggtcagctcgaccagcgacggccggtacaccttcaaggcccaggtcgcaccggat
caggcgcacaagcttcagatcgtctacttcaacgacggctatgtgaacgggcaggaccgc
aacctgctcgtcaagtcgctggaagtgaacggcaagcccgtcgcctccaccagctcgctg
gtcacctacgaccgcggcgcctccgacggcaaggacgtgattcccggccaggaaggcatg
tggtgggacggttcgctcgatttcgccctgaccaaggactatttcccggtcccgacgccg
ccggcccccgccggcaacacccaggtcatcctgaacctgcaaggcaacgccgcgggcggc
gtcaacgcgcatttcaacctgctgatcgatggcaagaaggtcggcgagggcgtcgccggc
acctcggccaaggactacgccttctcgatcaacgccacggcggatcaggcgcacaaggtc
cagatccagtacgacaacgacgccacggtgaacggccaggaccgcaacctgctggtcaac
aagatcaccatcaacggcaagtcggtcatgcccaccgacagcaacgtcacctatgacaag
ggtgccttggacggcaaggacgtggtcaagggccagtccggcatgtggtggaacggcacg
ctggtcgtcgacgccgacaagagcttcttccccggctcctccaacccgaccacgccgacc
aacccgccggcccccaccccgacgaagccgaccctgtcggtcagcgacgtctcggtgacc
gagccgaccggcaagaccaccggcatcgcgccgggcttcctgcacaccgagggcggccag
atcatggacagcagcggcaaggccgtgaagctgaccggcgtgaactggttcgggtccgag
ggctacgccttcgcgccgcaggggctgtggatggacagctaccagagccacatgaaccag
atgaaggatctgggcttcaacaccatccgcctgccctactccgacgcgatgctcgacaac
ggccgcatgccgaccggcatcgactattcgaagaaccccgacctgcgcggcaagacctcg
ctggaggtcttcgacaagatcatcgactacgccgacaagatcggcatgaagatcatcctc
gaccaccaccgctccggcgatggcgcgtcggccaacgagaacgggctctggtacaccagc
cagtacccggaatcgaagatgatcgagaactggaagatgctggcgacccgttacaagggc
aacgacgccgtcatcggcgccgacctgcacaacgagccgcacaacccggccacctggggc
gacggcggccccaacgactgggcccgcgccgcggagcgcatcggcaacgccatccagtcg
gtcaacaaggattggctgctgatcgtcgagggcatcgagacctaccagaaccagtggtac
tggtggggcggcaatctgctgggcgagaagaactacgaggtcaagttcaacgaaccgggc
aagctggtctactcggtccacgactacggtccgtcgctctacatgatggactggttcaag
gccaacaacttcccgaacaacatgccggcgaagtgggaccagatgtggggccacttcatc
cagaacgacgagaccccgatcctggtcggcgagttcggcagccgcatggaaaccgccatc
gacaaggcgtggatgcccaagctgatccagtacatgaacggcgactggaacggtgacggc
aagatcgacctcgccgcgggcgaccagggggcgagctggacctactgggcctggagcccc
ggctcgggcgacaccggcggcatcatgaacgacagctggaaggtggactacaacaagtac
aacgccatcaagcccggcctgtacagcagcaccgccgccagcccggtcaccaccgacgcc
gtgttcacggtgaagctgtcccaggcctacaaccagacggtgacggtggactacgccacg
gcggacggcacggccaaggccggttcggactatctggcgaccagcggcaagctgaccttc
gccgccggcgagaccaccaagacggtcgccgtcaaggtgctgagcgacgacgtggccgag
ggcgtcgagaccttcaacctgaagctctccaacccgacgcaggcgaccatcgccgacggg
accggcatcggcaccatcaacccgccgggctccgcccaggctctgtcggcggacatgctg
gcccacagcctggcccaggacacggcgacggtgcagtcggtgggcgtgcagtccgcgctc
gacctgtcgtcggtcgacttcacgcacatgatgacggtggacgccgtgaacctgatgctc
gaacatcaggccgcgtaa

DBGET integrated database retrieval system