KEGG   Azospirillum brasilense Sp245: AZOBR_p1120003Help
Entry
AZOBR_p1120003    CDS       T02152                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_p1120003 (gpmA)
   01230 Biosynthesis of amino acids
    AZOBR_p1120003 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_p1120003 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AZOBR_p1120003 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOBR_p1120003 (gpmA)
Enzymes [BR:abs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AZOBR_p1120003 (gpmA)
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AZOBR_p1120003 (gpmA)
  Exosomal proteins of melanoma cells
   AZOBR_p1120003 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(1132873..1133634)
Genome map
AA seq 253 aa AA seqDB search
MHRLVLLRHGQSVWNRSDLFTGWTDVDLTQQGIDETRHAAGLLKQAGFDFDVAFTSVLKR
AIRTLDIVLEEMDRMWLPVHKHWRLNERHYGALQGLNKTETAARHGADQVFLWRRSWDVP
PPPVEPEDPCSAVSDRRYAGIGRANLPRGESLKDTTDRVIPFWEEGICPALRLGARVLVS
AHGNSLRGLVKHLDKVPDQDIPLFEIPTSRPLVYELGADLVPLRRYFLTEGGGTEEITWT
RRDDTGLSGVVAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggctcgtgctgctgcggcacggtcagagcgtctggaaccgctcggatctgttc
accggctggaccgacgtcgatctgacccagcaggggattgacgaaacccgccacgccgcc
ggactgctgaagcaggccggattcgatttcgacgtggccttcacctccgtcctgaagcgg
gcgatcaggacactcgacatcgtgctggaggagatggaccggatgtggctgccggtgcac
aagcactggcgcctgaacgagcgccattacggcgcgctccaggggctgaacaagacggag
acggcggcccgccacggcgccgatcaggtcttcctgtggcggcggagctgggacgtcccg
cccccgccggtcgaacccgaggatccgtgctccgcggtgtcggaccggcgctacgccggg
atcggccgcgcgaacctgccgcgcggcgaaagcctgaaggacaccacggaccgggtgatc
cccttctgggaggagggcatctgcccggccctgcggctgggcgcgcgggtgctggtgtcg
gcccacggcaacagcctgcgcggcctcgtgaagcatctcgacaaggtgcccgaccaggac
atcccgctgttcgagatcccgaccagccgcccgctggtctacgagctgggcgccgatctg
gtcccgctgcgccgctacttcctgaccgagggcggcggaaccgaggagatcacctggacc
cgccgggacgacaccggcctgagcggagtcgtggcagcgtaa

DBGET integrated database retrieval system